Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 1.0e-05
osteosarcoma -1.647 1.2e-03
group 3 medulloblastoma 1.200 6.4e-03
subependymal giant cell astrocytoma 1.846 1.8e-02
lung carcinoma 1.200 8.9e-19
spina bifida -1.006 4.1e-02

 Compartment GO Term (0)

AA Sequence

MSGWIATSKTRMQDFWSLLTFSSDLVDVKDSGDYPLTAPGLSWKKFQGSFCEFVGTLVCRCQYILLHDDF      1 - 70
PMDNLISLLTGFSDSQVCAFCHTSTLAAMKLMTSLVRVALQLSLHEDINQRQYEAERNKGPGQRAPERLE     71 - 140
SLLEKHKELH                                                                141 - 150
//

Text Mined References (7)

PMID Year Title
23599027 2013 Genome-wide association study of age at menarche in African-American women.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10698974 2000 STAG3, a novel gene encoding a protein involved in meiotic chromosome pairing and location of STAG3-related genes flanking the Williams-Beuren syndrome deletion.