Property Summary

NCBI Gene PubMed Count 62
PubMed Score 130.43
PubTator Score 87.30

Knowledge Summary


No data available


  Disease (6)

Disease Target Count
Bladder Neoplasm 106
Myeloid Leukemia 19
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.3
Kidney cancer 2548 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 640 0.0 0.0332133175040823
Disease Target Count Z-score Confidence
Laryngotracheitis 10 5.395 2.7
Cancer 2388 3.168 1.6


  Differential Expression (27)

Disease log2 FC p
Alzheimer's disease 1.100 3.3e-02
Breast cancer 2.300 2.7e-02
acute quadriplegic myopathy 1.014 5.2e-05
adult high grade glioma 1.900 2.1e-03
astrocytic glioma 1.100 6.5e-03
Astrocytoma, Pilocytic 1.100 2.9e-03
atypical teratoid / rhabdoid tumor 2.000 4.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.101 8.3e-03
dermatomyositis 1.300 7.3e-04
diabetes mellitus -1.300 1.1e-03
Down syndrome 1.100 4.7e-03
ependymoma 1.400 2.9e-02
glioblastoma 1.200 9.4e-03
group 4 medulloblastoma 1.100 2.6e-02
juvenile dermatomyositis 1.065 2.9e-09
malignant mesothelioma 1.200 1.7e-05
medulloblastoma, large-cell 2.100 2.0e-05
Multiple myeloma 1.410 1.4e-02
oligodendroglioma 1.400 4.9e-02
osteosarcoma 2.683 3.9e-07
ovarian cancer -1.200 1.1e-05
pancreatic ductal adenocarcinoma liver m... 1.223 3.7e-02
Pick disease 1.800 4.7e-06
primitive neuroectodermal tumor 1.600 5.5e-04
psoriasis -1.200 3.5e-04
Rheumatoid arthritis 1.700 4.7e-03
Waldenstrons macroglobulinemia 1.588 1.1e-02

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

FDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVSMF                                1191 - 1231

Text Mined References (71)

PMID Year Title