Property Summary

NCBI Gene PubMed Count 26
PubMed Score 274.60
PubTator Score 72.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.100 1.4e-21
glioblastoma 1.400 1.1e-04
oligodendroglioma 1.100 8.6e-12
osteosarcoma -1.608 1.1e-05
posterior fossa group A ependymoma 1.500 4.2e-09
medulloblastoma 2.000 6.4e-11
medulloblastoma, large-cell 1.400 1.7e-03
primitive neuroectodermal tumor 1.400 1.3e-04
diabetes mellitus -1.200 1.4e-03
pediatric high grade glioma 1.500 3.2e-05
pilocytic astrocytoma 1.100 1.9e-04
aldosterone-producing adenoma -1.275 8.1e-03
Pick disease 1.300 5.2e-06
ovarian cancer -1.600 5.9e-11

Gene RIF (8)

PMID Text
24335498 Mutations in STAG1 is associated with acute myeloid leukemia.
24324008 cohesin-SA1 and cohesin-SA2 participate in the DNA damage response
23874961 Rad21 binds to SA proteins through two SA-binding motifs on Rad21.
22715410 Nuclear import and export signals of human cohesins SA1/STAG1 and SA2/STAG2 expressed in Saccharomyces cerevisiae.
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19822671 cohesin(SA1) and cohesin(SA2) are differentially required for telomere and centromere cohesion, respectively.
18550811 STAG1 (Scc3/SA1) subunit of cohesin interacts with the CCTC-binding factor CTCF bound to the c-myc insulator element.
15361841 STAG1, a novel transcriptional target for p53, mediates p53-dependent apoptosis, and might be a good candidate for next-generation gene therapy in cancer.

AA Sequence

MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRIEAGIRGAGRG      1 - 70
RANGHPQQNGEGEPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDLINFFIQCSGCRGTVRIEMFR     71 - 140
NMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCEFIGVLIRQCQYSIIYDEYMMDTVISLLTGL    141 - 210
SDSQVRAFRHTSTLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQEN    211 - 280
QDEIENMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKC    281 - 350
LKALQSLYTNRELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV    351 - 420
YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEHAAYLVDSLWE    421 - 490
SSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQ    491 - 560
IDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVES    561 - 630
DVLEACSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTS    631 - 700
FHNAHDLTKWDLFGNCYRLLKTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKEDLLVLRKTVK    701 - 770
SFLAVCQQCLSNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQPLVFNPDTGLQSELLSFVMDHVFID    771 - 840
QDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLIIYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSK    841 - 910
TRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKD    911 - 980
GIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRN    981 - 1050
SLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTST   1051 - 1120
VLRENSRPMGDQIQEPESEHGSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRTGVRHAVRGLM   1121 - 1190
EEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF     1191 - 1258
//

Text Mined References (31)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24335498 2014 Mutations in the cohesin complex in acute myeloid leukemia: clinical and prognostic implications.
24324008 2014 Distinct functions of human cohesin-SA1 and cohesin-SA2 in double-strand break repair.
23874961 2013 Characterization of the interaction between the cohesin subunits Rad21 and SA1/2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22715410 2012 Nuclear import and export signals of human cohesins SA1/STAG1 and SA2/STAG2 expressed in Saccharomyces cerevisiae.
21269460 2011 Initial characterization of the human central proteome.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
19822671 2009 Differential regulation of telomere and centromere cohesion by the Scc3 homologues SA1 and SA2, respectively, in human cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18550811 2008 CTCF physically links cohesin to chromatin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17962804 2007 Protein requirements for sister telomere association in human cells.
17349791 2007 Sororin is required for stable binding of cohesin to chromatin and for sister chromatid cohesion in interphase.
17113138 2006 Wapl controls the dynamic association of cohesin with chromatin.
17112726 2006 Human Wapl is a cohesin-binding protein that promotes sister-chromatid resolution in mitotic prophase.
16682347 2006 Human Scc4 is required for cohesin binding to chromatin, sister-chromatid cohesion, and mitotic progression.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15855230 2005 Functional contribution of Pds5 to cohesin-mediated cohesion in human cells and Xenopus egg extracts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361841 2004 Identification of STAG1 as a key mediator of a p53-dependent apoptotic pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12034751 2002 STAG2 and Rad21 mammalian mitotic cohesins are implicated in meiosis.
11590136 2001 A potential role for human cohesin in mitotic spindle aster assembly.
11076961 2000 Characterization of vertebrate cohesin complexes and their regulation in prophase.
9305759 1997 SA-1, a nuclear protein encoded by one member of a novel gene family: molecular cloning and detection in hemopoietic organs.