Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1524.74
PubTator Score 211.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 5.000 8.3e-07
atypical teratoid / rhabdoid tumor 3.200 6.9e-05
medulloblastoma, large-cell 1.200 1.2e-02
primitive neuroectodermal tumor 4.100 8.4e-04
Breast cancer -1.300 6.6e-23

 GWAS Trait (1)

Gene RIF (18)

PMID Text
27105834 the relationships between psychiatric disorders and polySia and/or ST8SIA2
26418860 Data indicate a possible role of STX polysialyltransferase (ST8SIA2) in the common susceptibility of schizophrenia and bipolar I disorder (BD-I).
24651862 the role of ST8SIA2 sequence variation affecting polysialic acid-NCAM formation in 48 Caucasian cases with bipolar disorder
24070986 Our study showed interesting sex-specific associations between ST8SIAII and schizophrenia.
23671285 translational modification of the neural cell adhesion molecule NCAM and the polysialyltransferase ST8SiaII in mammalian semen involves polysialic acid
23643386 Expression of ST8SIA2 in omental fat at baseline was significantly associated with weight loss after Roux-en-Y gastric bypass.
22693595 that variation the ST8SIA2 gene is associated with increased risk to mental illness
22281821 NCAM and polySia are expressed and developmentally regulated in chick corneas. Both membrane-associated and soluble NCAM isoforms are expressed in chick corneas.
21555518 ST8SIA2 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21464126 STX(G421A) shows a dramatic decrease in polySia synthetic activity on NCAM, whereas STX(C621G) does not; polySia shows a dopamine (DA) binding activity
20663923 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20386566 This study provided that ST8SIA2 are associated with Bipolar I in the Han Chinese population.
19336400 Amino acid substitutions in conserved sequences are critical for the protein-specific polysialylation of NCAM.
17126533 Observational study of gene-disease association. (HuGE Navigator)
16229822 Observational study of gene-disease association. (HuGE Navigator)
16229822 SIAT8B gene is involved in schizophrenia in the Japanese.
15710344 The upregulation of ST8SIA4 and the donwregulation of ST8SIA2 by valproic acid in HUVEC and tumor cell lines are reported.
12138100 SIAT8B has a role in neural development and sialic acid synthesis on NCAM

AA Sequence

MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDR      1 - 70
SNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLY     71 - 140
ELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVI    141 - 210
QRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVR    211 - 280
GYWLTNKVHIKRPTTGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPL    281 - 350
EFKALKSLHEQGALKLTVGQCDGAT                                                 351 - 375
//

Text Mined References (32)

PMID Year Title
27105834 2016 Relationship between ST8SIA2, polysialic acid and its binding molecules, and psychiatric disorders.
26418860 2015 Association between ST8SIA2 and the Risk of Schizophrenia and Bipolar I Disorder across Diagnostic Boundaries.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24651862 2014 Characterisation of genetic variation in ST8SIA2 and its interaction region in NCAM1 in patients with bipolar disorder.
24070986 2013 Sex-specific association of the ST8SIAII gene with schizophrenia in a Spanish population.
23671285 2013 Polysialic acid is present in mammalian semen as a post-translational modification of the neural cell adhesion molecule NCAM and the polysialyltransferase ST8SiaII.
23643386 2013 Weight loss after gastric bypass is associated with a variant at 15q26.1.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22693595 2012 Identification of sialyltransferase 8B as a generalized susceptibility gene for psychotic and mood disorders on chromosome 15q25-26.
22281821 2012 Expression and localization of neural cell adhesion molecule and polysialic acid during chick corneal development.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21464126 2011 Structural and functional impairments of polysialic acid by a mutated polysialyltransferase found in schizophrenia.
20663923 2010 A genome-wide scan for common alleles affecting risk for autism.
20386566 2011 Genome-wide association study of bipolar I disorder in the Han Chinese population.
19336400 2009 Identification of sequences in the polysialyltransferases ST8Sia II and ST8Sia IV that are required for the protein-specific polysialylation of the neural cell adhesion molecule, NCAM.
17126533 2007 Positive association between SIAT8B and schizophrenia in the Chinese Han population.
16229822 2006 Association between polymorphisms in the promoter region of the sialyltransferase 8B (SIAT8B) gene and schizophrenia.
15710344 2005 Valproic acid modulates NCAM polysialylation and polysialyltransferase mRNA expression in human tumor cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138100 2002 ST8Sia II and ST8Sia IV polysialyltransferases exhibit marked differences in utilizing various acceptors containing oligosialic acid and short polysialic acid. The basis for cooperative polysialylation by two enzymes.
11744634 2001 The polysialyltransferase ST8Sia II/STX: posttranslational processing and role of autopolysialylation in the polysialylation of neural cell adhesion molecule.
10766765 2000 Differential biosynthesis of polysialic acid on neural cell adhesion molecule (NCAM) and oligosaccharide acceptors by three distinct alpha 2,8-sialyltransferases, ST8Sia IV (PST), ST8Sia II (STX), and ST8Sia III.
9852130 1998 In vivo autopolysialylation and localization of the polysialyltransferases PST and STX.
9054414 1997 Human STX polysialyltransferase forms the embryonic form of the neural cell adhesion molecule. Tissue-specific expression, neurite outgrowth, and chromosomal localization in comparison with another polysialyltransferase, PST.
8702635 1996 Characterization of mouse ST8Sia II (STX) as a neural cell adhesion molecule-specific polysialic acid synthase. Requirement of core alpha1,6-linked fucose and a polypeptide chain for polysialylation.
8027041 1994 Differential expression of five sialyltransferase genes in human tissues.
7588599 1995 An investigation of the role of transmembrane domains in Golgi protein retention.
7559389 1995 A human STX cDNA confers polysialic acid expression in mammalian cells.