Property Summary

NCBI Gene PubMed Count 77
PubMed Score 255.23
PubTator Score 131.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 4.000 2.5e-08
ependymoma 1.200 4.2e-03
oligodendroglioma 1.300 7.4e-03
osteosarcoma -2.135 2.9e-03
group 4 medulloblastoma 2.200 6.9e-04
astrocytoma 1.400 5.0e-02
glioblastoma 1.400 2.1e-02
periodontitis 1.700 1.1e-29
medulloblastoma, large-cell 2.100 7.1e-04
pancreatic ductal adenocarcinoma liver m... -3.105 6.0e-03
lung cancer -2.200 1.0e-04
interstitial cystitis 2.400 3.9e-05
cystic fibrosis -1.800 5.0e-04
pilocytic astrocytoma 1.500 5.0e-07
primary Sjogren syndrome 1.900 6.7e-04
acute myeloid leukemia -1.800 3.1e-02
ovarian cancer 1.700 2.8e-04
facioscapulohumeral dystrophy 2.200 1.8e-08

Gene RIF (43)

PMID Text
26304831 Collectively, our data indicate that ST6GAL1 plays an important role in the regulation of pluripotency and differentiation in hPSCs.
26258617 Expression levels of sialyltransferases ST3GAL1 and ST3GAL4 were upregulated in the HRMECs after high-glucose stimulation.
26224120 Data indicate that O-glycan-specific alpha2,6 sialyltransferase regulate cancer growth and metastasis by regulating galectins Gal-1- and Gal-3-binding moieties on O-glycans.
26054692 These results suggest a role for ST6Gal-I to promote the growth and invasion of osteosarcoma cells.
25867765 CDX2 transcriptionally regulates ST6GalNAc-I gene expression, specifically in the preneoplastic intestinal metaplasia lesion.
25573487 Sialylation by beta-galactoside alpha-2,6-sialyltransferase regulates cell adhesion and invasion in human anaplastic large cell lymphoma.
25566667 The lymphocyte levels of NEU1 and ST6GAL1 mRNA expression are significantly increased in erythremia.
25465919 Study characterizes ST6GAL1 expression loss caused by aberrant ST6GAL1 promoter methylation potentially indicating a tumor suppressive role in bladder carcinogenesis.
25344606 ST6GAL1 promotes TGF-beta-dependent epithelial-mesenchymal transition
24606438 The study detected only one allele of each polymorphism in the ST6GAL1P1 promoter.
24454800 ST6GAL1 is responsible for the development of multidrug resistance in human leukemia cells probably through medicating the activity of PI3K/Akt signaling.
23999306 A large glycan from a symmetry mate localizes to the active site of ST6Gal-I in an orientation compatible with catalysis. The glycan binding mode can be generalized to any glycoprotein that is a substrate of ST6Gal-I.
23549466 the high expression of ST3Gal I and ST6Gal I, in skin tumors, is associated with tumors with greater potential for invasion and metastasis, as in the case of squamous cell carcinoma, and this may be related to their behavior.
23504322 the suppressive role of Necl-2 in the HRG-induced ErbB2/ErbB3 signaling is regulated by miR-199a at least through the reduction of the ST6GAL1-catalyzed sialylation of Necl-2
23358684 ST6Gal-I protein expression is upregulated in epithelial tumors.
22449099 Our results suggest that soluble ST6Gal may participate in cancer progression and metastasis prior to being secreted from cancer cells
21930713 ST6Gal-I regulates macrophage apoptosis via alpha2-6 sialylation of the TNFR1 death receptor.
21778787 CDw75 expression in colorectal tumoural tissue was correlated with growth pattern (p = 0.044), Dukes stage (p = 0.002), TNM stage (p = 0.020) and distant metastasis (p = 0.005).
21550977 Sialylation of the Fas death receptor by ST6Gal-I provides protection against Fas-mediated apoptosis in colon carcinoma cells.
21147760 the occurrence of CD75s- and iso-CD75s-gangliosides in tumor tissues is largely independent of the transcriptional expression of ST6GAL1 and ST3GAL6
21140242 These results indicated that gastric cancer tissues expressed high levels of alpha 2,3-linked sialic acid residues, ST3Gal IV, and ST6Gal I.
20656882 ST6Gal I is responsible for ST2H antigen biosynthesis in human colon cancer cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20127017 Adhesion of ST6Gal I-mediated human colon cancer cells to fibronectin contributes to cell survival by integrin beta1-mediated paxillin and AKT activation.
20003255 enhanced tumour ST6Gal I activity and an increased CDw75 expression may play a role in malignant transformation of colorectal cancer
19709745 ST6Gal I and ST3Gal V were positively correlated with the high risk of pediatric acute leukemia.
19413643 DBA.44(CD76) patterns of expression would help the pathologist to recognize the morphological pattern of the different subgroups of splenic marginal zone lymphomas
19170967 Activity of alpha2,6-sialyltransferase and its gene expression in peripheral B lymphocytes in patients with IgA nephropathy.
19150807 There are two possible mechanisms for the upregulation of plasma ST6Gal I in hepatopathological situations: one accompanied by acute phase reactions to increase hepatic ST6Gal I expression and the other triggered by oxidative stress in the liver.
19013288 Alcohol-mediated down-regulation of hepatic ST6Gal1 gene leads to defective intracellular lipid and lipoprotein transport, which in turn may contribute to alcoholic steatosis.
18650447 Proteolytic shedding of ST6Gal-I by BACE1 regulates the glycosylation and function of alpha4beta1 integrins
17897958 soluble ST6Gal I produced by BACE1 plays, at least in part, a role in the sialylation of soluble glycoproteins
17697868 Appearance of asialoconjugates in alcoholics is possibly due to the down-regulation of ST6GalI gene expression.
17441333 siRNA targeting to ST6Gal I can effectively downregulate the ST6Gal I expression in HeLa cell and further lead to the decline of cell adhesion and invasiveness to ECM.
16319516 ST6Gal I is upregulated in tumor and transitional tissues from colorectal cancer patients
16192407 the presence of alpha2,6-linked sialic acid added by ST6Gal.I on membrane glycoconjugates increases the binding to extracellular matrix components, resulting in a membrane stabilization of beta1 integrins, further strengthening the binding
16053379 sialyltransferases expression and activity are increased in Grave's disease
14514712 Neoplastic transformation but not cirrhosis can alter the process of alpha2,6-sialylation of liver glycoproteins.
12943659 specific kinase enzymes have important roles in the expression and catalytic activity of the alpha2,6 STN (ST6N) isozyme
12931020 High levels of ST6GAL-I in the tumor tissue correlated with secondary local tumor recurrence (p = 0.005; p = 0.012).
12878221 Transcriptional activation of beta-galactoside alpha2,6-sialyltransferase in colon adenocarcinoma cells.
12798701 Expression of alpha 2,6-sialyltransferase ST6Gal I is enhanced in cervical squamous cell carcinoma.
12499376 ST6Gal I sialyltransferase has a role in regulating galectin-1-induced CD45 clustering, phosphatase modulation, and T cell death

AA Sequence

MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQD      1 - 70
PHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEAL     71 - 140
RCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLR    141 - 210
FNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNN    211 - 280
YKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKT    281 - 350
DVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC                  351 - 406
//

Text Mined References (80)

PMID Year Title
26304831 2015 Glycosyltransferase ST6GAL1 contributes to the regulation of pluripotency in human pluripotent stem cells.
26258617 2015 Alteration of N-Glycan Profiles in Diabetic Retinopathy.
26224120 2015 Galectin-Binding O-Glycosylations as Regulators of Malignancy.
26054692 2015 Knockdown of ST6Gal-I inhibits the growth and invasion of osteosarcoma MG-63 cells.
25867765 2015 CDX2 homeoprotein is involved in the regulation of ST6GalNAc-I gene in intestinal metaplasia.
25573487 2015 Sialylation by ?-galactoside ?-2,6-sialyltransferase and N-glycans regulate cell adhesion and invasion in human anaplastic large cell lymphoma.
25566667 2014 [Glycoprotein sialylation and NEU1 and ST6GAL1 expressions in erythremia].
25465919 2014 Epigenetic inactivation of ST6GAL1 in human bladder cancer.
25344606 2014 ?-Galactoside ?2,6-sialyltranferase 1 promotes transforming growth factor-?-mediated epithelial-mesenchymal transition.
24606438 2014 Promoter polymorphisms of ST3GAL4 and ST6GAL1 genes and associations with risk of premalignant and malignant lesions of the cervix.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24454800 2014 Reversal effect of ST6GAL 1 on multidrug resistance in human leukemia by regulating the PI3K/Akt pathway and the expression of P-gp and MRP1.
23999306 2013 The structure of human ?-2,6-sialyltransferase reveals the binding mode of complex glycans.
23549466 2013 Expression patterns of ?2,3-sialyltransferase I and ?2,6-sialyltransferase I in human cutaneous epithelial lesions.
23504322 2013 Reduction of the ST6 ?-galactosamide ?-2,6-sialyltransferase 1 (ST6GAL1)-catalyzed sialylation of nectin-like molecule 2/cell adhesion molecule 1 and enhancement of ErbB2/ErbB3 signaling by microRNA-199a.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23358684 2013 ST6Gal-I protein expression is upregulated in human epithelial tumors and correlates with stem cell markers in normal tissues and colon cancer cell lines.
22960999 2012 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.
22449099 2012 Cleavage of ST6Gal I by radiation-induced BACE1 inhibits golgi-anchored ST6Gal I-mediated sialylation of integrin ?1 and migration in colon cancer cells.
21930713 2011 ST6Gal-I regulates macrophage apoptosis via ?2-6 sialylation of the TNFR1 death receptor.
21874001 2011 Genome-wide association study in individuals of South Asian ancestry identifies six new type 2 diabetes susceptibility loci.
21778787 2011 Disease-free survival of colorectal cancer patients in relation to CDw75 antigen expression.
21550977 2011 Sialylation of the Fas death receptor by ST6Gal-I provides protection against Fas-mediated apoptosis in colon carcinoma cells.
21147760 2011 Differences in CD75s- and iso-CD75s-ganglioside content and altered mRNA expression of sialyltransferases ST6GAL1 and ST3GAL6 in human hepatocellular carcinomas and nontumoral liver tissues.
21140242 2012 Altered mRNA expressions of sialyltransferases in human gastric cancer tissues.
21130132 2011 Genome-wide association study of blood pressure response to methylphenidate treatment of attention-deficit/hyperactivity disorder.
21081508 2011 Universal phosphatase-coupled glycosyltransferase assay.
20656882 2010 Involvement of ST6Gal I in the biosynthesis of a unique human colon cancer biomarker candidate, alpha2,6-sialylated blood group type 2H (ST2H) antigen.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20127017 2010 Adhesion of ST6Gal I-mediated human colon cancer cells to fibronectin contributes to cell survival by integrin beta1-mediated paxillin and AKT activation.
20003255 2009 Synthesis and expression of CDw75 antigen in human colorectal cancer.
19709745 2010 Elevated mRNA level of hST6Gal I and hST3Gal V positively correlates with the high risk of pediatric acute leukemia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19483685 2009 HLA-B*5701 genotype is a major determinant of drug-induced liver injury due to flucloxacillin.
19413643 2009 Among 157 marginal zone lymphomas, DBA.44(CD76) expression is restricted to tumour cells infiltrating the red pulp of the spleen with a diffuse architectural pattern.
19170967 2009 Activity of alpha2,6-sialyltransferase and its gene expression in peripheral B lymphocytes in patients with IgA nephropathy.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19150807 2009 Molecular insights into beta-galactoside alpha2,6-sialyltransferase secretion in vivo.
19013288 2008 Down-regulation of liver Galbeta1, 4GlcNAc alpha2, 6-sialyltransferase gene by ethanol significantly correlates with alcoholic steatosis in humans.
18650447 2008 Proteolytic shedding of ST6Gal-I by BACE1 regulates the glycosylation and function of alpha4beta1 integrins.
17897958 2007 Beta-galactoside alpha2,6-sialyltransferase I cleavage by BACE1 enhances the sialylation of soluble glycoproteins. A novel regulatory mechanism for alpha2,6-sialylation.
17697868 2007 Liver Galbeta1,4GlcNAc alpha2,6-sialyltransferase is down-regulated in human alcoholics: possible cause for the appearance of asialoconjugates.
17441333 2007 [Combinatorial effects of ST6Gal I siRNA and antisense oligonucleotide-mediated gene silence on metastasis ability of cervical carcinoma cells].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16319516 2005 Elevation of ST6Gal I activity in malignant and transitional tissue in human colorectal cancer.
16237761 2005 Screening of hepatocyte proteins binding to F protein of hepatitis C virus by yeast two-hybrid system.
16192407 2006 Phenotypic changes induced by expression of beta-galactoside alpha2,6 sialyltransferase I in the human colon cancer cell line SW948.
16053379 2005 Thyroid sialyltransferase mRNA level and activity are increased in Graves' disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14514712 2004 Expression of beta-galactoside alpha2,6 sialyltransferase and of alpha2,6-sialylated glycoconjugates in normal human liver, hepatocarcinoma, and cirrhosis.
12943659 2003 The role of protein phosphorylation in alpha2,6(N)-sialyltransferase activity.
12931020 2003 Clinical relevance of sialyltransferases ST6GAL-I and ST3GAL-III in gastric cancer.
12878221 2003 Transcriptional regulation of human beta-galactoside alpha2,6-sialyltransferase (hST6Gal I) gene in colon adenocarcinoma cell line.
12798701 2003 Enhanced expression of alpha 2,6-sialyltransferase ST6Gal I in cervical squamous cell carcinoma.
12692561 2003 A method for the comprehensive proteomic analysis of membrane proteins.
12499376 2003 The ST6Gal I sialyltransferase selectively modifies N-glycans on CD45 to negatively regulate galectin-1-induced CD45 clustering, phosphatase modulation, and T cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11356854 2001 Location and mechanism of alpha 2,6-sialyltransferase dimer formation. Role of cysteine residues in enzyme dimerization, localization, activity, and processing.
11320056 2001 Characterization of sialyltransferase mutants using surface plasmon resonance.
10460832 1999 Transcription of the beta-galactoside alpha2,6-sialyltransferase gene (SIAT1) in B-lymphocytes: cell type-specific expression correlates with presence of the divergent 5'-untranslated sequence.
9110174 1997 Large-scale concatenation cDNA sequencing.
8995311 1997 Two naturally occurring alpha2,6-sialyltransferase forms with a single amino acid change in the catalytic domain differ in their catalytic activity and proteolytic processing.
8953271 1996 Systematic nomenclature for sialyltransferases.
8920923 1996 Novel heterogeneity exists in the 5'-untranslated region of the beta-galactoside alpha 2,6-sialytransferase mRNAs in the human B-lymphoblastoid cell line, louckes.
8724135 1996 Transcription of the beta-galactoside alpha 2,6-sialyltransferase gene in B lymphocytes is directed by a separate and distinct promoter.
8702538 1996 A single N-linked glycosylation site is implicated in the regulation of ligand recognition by the I-type lectins CD22 and CD33.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8477718 1993 Cell-specific expression of human beta-galactoside alpha 2,6-sialyltransferase transcripts differing in the 5' untranslated region.
8144653 1994 Cytokine-induced beta-galactoside alpha-2,6-sialyltransferase in human endothelial cells mediates alpha 2,6-sialylation of adhesion molecules and CD22 ligands.
7786324 1993 Chromosome mapping and organization of the human beta-galactoside alpha 2,6-sialyltransferase gene. Differential and cell-type specific usage of upstream exon sequences in B-lymphoblastoid cells.
7768954 1995 Chaperone function of a Grp 94-related protein for folding and transport of the pancreatic bile salt-dependent lipase.
7615680 1995 Mapping the distribution of Golgi enzymes involved in the construction of complex oligosaccharides.
2803295 1989 Isolation and characterization of a partial cDNA for a human sialyltransferase.
2408023 1990 Complete cDNA sequence encoding human beta-galactoside alpha-2,6-sialyltransferase.
2373995 1990 The B cell antigen CD75 is a cell surface sialytransferase.
1730763 1992 The HB-6, CDw75, and CD76 differentiation antigens are unique cell-surface carbohydrate determinants generated by the beta-galactoside alpha 2,6-sialyltransferase.