Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.83
PubTator Score 14.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
gastric cancer 1.100 4.7e-03
pancreatic cancer 1.500 8.7e-04
Multiple myeloma 2.366 1.4e-02
malignant mesothelioma -1.700 1.7e-06
psoriasis -1.200 5.1e-03
osteosarcoma -2.092 2.5e-03
ependymoma -1.300 8.8e-04
cystic fibrosis 1.400 1.9e-05
atypical teratoid / rhabdoid tumor -2.500 5.7e-07
group 3 medulloblastoma -1.500 2.0e-02
medulloblastoma, large-cell -2.500 1.9e-05
fascioscapulohumeral muscular dystrophy 1.082 4.6e-04
adrenocortical carcinoma -1.214 2.2e-02
pancreatic ductal adenocarcinoma liver m... -2.123 2.0e-03
tuberculosis and treatment for 6 months -1.600 8.3e-04
non-small cell lung cancer -1.168 5.5e-15
intraductal papillary-mucinous carcinoma... -2.000 3.6e-02
lung cancer -2.700 3.3e-05
interstitial cystitis 1.100 2.0e-03
pilocytic astrocytoma 1.300 2.2e-03
pancreatic carcinoma 1.500 8.7e-04
Endometriosis -1.598 3.2e-02
lung carcinoma -1.400 4.2e-13
Pick disease -1.100 1.5e-05
Breast cancer -2.000 2.5e-08
invasive ductal carcinoma -1.500 2.4e-03
ovarian cancer -2.800 7.2e-11

Protein-protein Interaction (3)

Gene RIF (5)

PMID Text
25061176 The sialyltransferase ST3GAL6 influences homing and survival in multiple myeloma.
21147760 the occurrence of CD75s- and iso-CD75s-gangliosides in tumor tissues is largely independent of the transcriptional expression of ST6GAL1 and ST3GAL6
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19781661 Expression of ST3Gal IV in several gastrointestinal cell lines is correlated with the expression of sialyl Lewis x at the cell surface.
18485915 Epigenetic changes in a group of glycosyltransferases including B4GALNT2 and ST3GAL6 represent a malignant phenotype of gastric cancer caused by silencing of the activity of these enzymes

AA Sequence

MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFR      1 - 70
KIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYD     71 - 140
VIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNG    141 - 210
FWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFK    211 - 280
YNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD                       281 - 331
//

Text Mined References (22)

PMID Year Title
25061176 2014 The sialyltransferase ST3GAL6 influences homing and survival in multiple myeloma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22700726 2012 Coordinated roles of ST3Gal-VI and ST3Gal-IV sialyltransferases in the synthesis of selectin ligands.
22649524 2012 A fine-mapping study of 7 top scoring genes from a GWAS for major depressive disorder.
22025563 2011 Selectin ligand sialyl-Lewis x antigen drives metastasis of hormone-dependent breast cancers.
21147760 2011 Differences in CD75s- and iso-CD75s-ganglioside content and altered mRNA expression of sialyltransferases ST6GAL1 and ST3GAL6 in human hepatocellular carcinomas and nontumoral liver tissues.
20826224 2010 A functional analysis of N-glycosylation-related genes on sialylation of recombinant erythropoietin in six commonly used mammalian cell lines.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
19781661 2010 Differential expression of alpha-2,3-sialyltransferases and alpha-1,3/4-fucosyltransferases regulates the levels of sialyl Lewis a and sialyl Lewis x in gastrointestinal carcinoma cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18485915 2008 DNA hypermethylation contributes to incomplete synthesis of carbohydrate determinants in gastrointestinal cancer.
17944600 2008 IL-6 and IL-8 increase the expression of glycosyltransferases and sulfotransferases involved in the biosynthesis of sialylated and/or sulfated Lewisx epitopes in the human bronchial mucosa.
17662891 2007 N-glycan structures and associated gene expression reflect the characteristic N-glycosylation pattern of human hematopoietic stem and progenitor cells.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11587543 2001 Gene structure and transcriptional regulation of human Gal beta1,4(3) GlcNAc alpha2,3-sialyltransferase VI (hST3Gal VI) gene in prostate cancer cell line.
10206952 1999 Molecular cloning of a novel alpha2,3-sialyltransferase (ST3Gal VI) that sialylates type II lactosamine structures on glycoproteins and glycolipids.