Property Summary

NCBI Gene PubMed Count 30
PubMed Score 62.94
PubTator Score 74.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.100 4.4e-08
sonic hedgehog group medulloblastoma -1.500 6.1e-06
atypical teratoid / rhabdoid tumor -1.300 2.2e-04
medulloblastoma, large-cell -1.500 2.7e-05
non-small cell lung cancer -1.158 1.7e-07
colon cancer -1.400 4.3e-02
lung cancer -2.900 6.8e-06
interstitial cystitis -1.600 3.2e-05
posterior fossa group B ependymoma -1.400 2.2e-10
lung carcinoma -1.800 1.3e-21
ovarian cancer -2.700 2.5e-17

Protein-protein Interaction (2)

Gene RIF (20)

PMID Text
26729095 Serum deprivation triggers upregulation of hST3Gal V gene expression through Runx2 activation by BMP signaling in MG-63 cells.
24531716 this study indicated that sialylation involved in the development of MDR of AML cells probably through ST3GAL5 or ST8SIA4 regulating the activity of PI3K/Akt signaling and the expression of P-gp and MRP1.
24026681 Whole-exome sequencing of patients with salt and pepper syndrome shows a homozygous c.994G>A transition (p.E332K) in the ST3GAL5 gene.
22990144 GM3 synthase deficiency, responsible for early-onset epilepsy syndrome, leads to a secondary respiratory chain dysfunction.
21699754 Data demonstrate that valproic acid (VPA) transcriptionally regulates human GM3 synthase (hST3Gal V), which catalyzes ganglioside GM3 biosynthesis in ARPE-19 human retinal pigment epithelial cells.
21571640 GM3 exhibits the potential to regulate the allosteric structural transition from inactive to a signaling EGFR dimer, by preventing the autophosphorylation of the intracellular kinase domain in response to ligand binding
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20219466 In vivo expression of the transcript gives rise to two human ST3Gal-V isoforms with distinct characteristics.
19759399 GM3 synthase overexpression results in reduced cell motility and in caveolin-1 upregulation in human ovarian carcinoma cells
19709745 ST6Gal I and ST3Gal V were positively correlated with the high risk of pediatric acute leukemia.
19415461 GM3 synthase mRNA levels were significantly higher in differentiated human monocyte-derived macrophages compared to monocytes and in atherosclerotic aorta compared to normal aorta
18974200 Ganglioside GM3 inhibits VEGF/VEGFR-2-mediated angiogenesis. Direct interaction of GM3 with VEGFR-2 is reported.
18480157 GM3 synthase point mutation almost completely depletes human fibroblast cellular gangliosides, dampens membrane EGFR activation, and modulates related critical cell functions such as proliferation and migration
18187620 Knockdown of ST3 beta-galactoside alpha-2,3-sialyltransferase 5 (ST3GAL5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18051367 HIV-1 NC upregulates ST3 beta-galactoside alpha-2,3-sialyltransferase 5 in HEK 293T cells
16934889 These results are the first demonstration of the existence of a new isoform of human GM3 synthase, which could play an important role during HL60 cell differentiation.
15502825 ). We sequenced genes in the region and identified a nonsense mutation in SIAT9, which is predicted to result in the premature termination of the GM3 synthase enzyme (also called lactosylceramide alpha-2,3 sialyltransferase).
15385432 enhanced expression of GM3 synthase through protein kinase C /extracellular regulated kinases-dependent cAMP-responsive element binding protein activation by phorbol 12-myristate 13-acetate is associated with the differentiation of HL-60 cells
12393190 isolation and characterization of the promoter region

AA Sequence

MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKC      1 - 70
TLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVD     71 - 140
LLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELG    141 - 210
HTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKK    211 - 280
ETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLAT    281 - 350
HLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF      351 - 418
//

Text Mined References (31)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26729095 2015 Serum Deprivation-Induced Human GM3 Synthase (hST3Gal V) Gene Expression Is Mediated by Runx2 in Human Osteoblastic MG-63 Cells.
24531716 2015 Modification of sialylation is associated with multidrug resistance in human acute myeloid leukemia.
24026681 2014 A mutation in a ganglioside biosynthetic enzyme, ST3GAL5, results in salt & pepper syndrome, a neurocutaneous disorder with altered glycolipid and glycoprotein glycosylation.
22990144 2013 Refractory epilepsy and mitochondrial dysfunction due to GM3 synthase deficiency.
21699754 2011 Transcriptional activation of human GM3 synthase (hST3Gal V) gene by valproic acid in ARPE-19 human retinal pigment epithelial cells.
21571640 2011 Regulation of human EGF receptor by lipids.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20219466 2010 Two active and differently N-glycosylated isoforms of human ST3Gal-V are produced from the placental mRNA variant by a leaky scanning mechanism.
19759399 2010 GM3 synthase overexpression results in reduced cell motility and in caveolin-1 upregulation in human ovarian carcinoma cells.
19709745 2010 Elevated mRNA level of hST6Gal I and hST3Gal V positively correlates with the high risk of pediatric acute leukemia.
19415461 2009 Enhancing of GM3 synthase expression during differentiation of human blood monocytes into macrophages as in vitro model of GM3 accumulation in atherosclerotic lesion.
18974200 2009 Ganglioside GM3 inhibits VEGF/VEGFR-2-mediated angiogenesis: direct interaction of GM3 with VEGFR-2.
18480157 2008 Ganglioside depletion and EGF responses of human GM3 synthase-deficient fibroblasts.
16934889 2006 Human GM3 synthase: a new mRNA variant encodes an NH2-terminal extended form of the protein.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15502825 2004 Infantile-onset symptomatic epilepsy syndrome caused by a homozygous loss-of-function mutation of GM3 synthase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385432 2005 Molecular mechanism for transcriptional activation of ganglioside GM3 synthase and its function in differentiation of HL-60 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12527423 2003 Characterization of the 5'-flanking fragment of the human GM3-synthase gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393190 2002 Isolation and characterization of the promoter region of the human GM3 synthase gene.
11595162 2001 Genomic structure of human GM3 synthase gene (hST3Gal V) and identification of mRNA isoforms in the 5'-untranslated region.
11030748 2000 Evidence supporting a late Golgi location for lactosylceramide to ganglioside GM3 conversion.
10619706 1999 Combinatorial PCR approach to homology-based cloning: cloning and expression of mouse and human GM3-synthase.
10092602 1999 Expression cloning of mouse cDNA of CMP-NeuAc:Lactosylceramide alpha2,3-sialyltransferase, an enzyme that initiates the synthesis of gangliosides.
9822625 1998 Expression cloning and functional characterization of human cDNA for ganglioside GM3 synthase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.