Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 3.4e-06
primitive neuroectodermal tumor 3031 2.1e-04
psoriasis 6685 1.0e-03
Disease Target Count Z-score Confidence
Q fever 11 4.344 2.2
Brugada syndrome 26 3.833 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.300 1.0e-03
osteosarcoma -3.016 3.4e-06
primitive neuroectodermal tumor 1.700 2.1e-04

Synonym

Accession Q9HBF5
Symbols HCCS-1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTK      1 - 70
TIANTYFYF                                                                  71 - 79
//

Text Mined References (4)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
11857354 2002 Candidate tumor suppressor, HCCS-1, is downregulated in human cancers and induces apoptosis in cervical cancer.