Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.95
PubTator Score 19.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -1.600 1.7e-05
Astrocytoma, Pilocytic -2.900 5.7e-04
atypical teratoid/rhabdoid tumor -2.100 2.2e-02
Down syndrome 1.800 1.0e-03
ependymoma -3.400 2.9e-02
glioblastoma -1.600 4.6e-02
group 4 medulloblastoma 4.600 2.3e-04
lung cancer 1.800 2.1e-03
lung carcinoma 5.700 8.5e-70
malignant mesothelioma -3.600 9.1e-09
non primary Sjogren syndrome sicca -1.200 1.9e-02
oligodendroglioma -1.700 1.1e-04
pediatric high grade glioma -2.000 2.3e-02
pituitary cancer -2.600 3.1e-03
progressive supranuclear palsy -2.200 2.1e-02
subependymal giant cell astrocytoma -5.157 3.2e-03

Gene RIF (8)

AA Sequence

MDAEAEDKTLRTRSKGTEVPMDSLIQELSVAYDCSMAKKRTAEDQALGVPVNKRKSLLMKPRHYSPKADC      1 - 70
QEDRSDRTEDDGPLETHGHSTAEEIMIKPMDESLLSTAQENSSRKEDRYSCYQELMVKSLMHLGKFEKNV     71 - 140
SVQTVSENLNDSGIQSLKAESDEADECFLIHSDDGRDKIDDSQPPFCSSDDNESNSESAENGWDSGSNFS    141 - 210
EETKPPRVPKYVLTDHKKDLLEVPEIKTEGDKFIPCENRCDSETERKDPQNALAEPLDGNAQPSFPDVEE    211 - 280
EDSESLAVMTEEGSDLEKAKGNLSLLEQAIALQAERGCVFHNTYKELDRFLLEHLAGERRQTKVIDMGGR    281 - 350
QIFNNKHSPRPEKRETKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGR    351 - 420
GHVNSNRNTHRSLSGCPIAAAEKLAMSQDKNQLDSPQTGQCPDQAHRTSLVKQIEFNFPSQAITSPRATV    421 - 490
SKEQEKFGKVPFDYASFDAQVFGKRPLIQTVQGRKTPPFPESKHFPNPVKFPNRLPSAGAHTQSPGRASS    491 - 560
YSYGQCSEDTHIAAAAAILNLSTRCREATDILSNKPQSLHAKGAEIEVDENGTLDLSMKKNRILDKSAPL    561 - 630
TSSNTSIPTPSSSPFKTSSILVNAAFYQALCDQEGWDTPINYSKTHGKTEEEKEKDPVSSLENLEEKKFP    631 - 700
GEASIPSPKPKLHARDLKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPT    701 - 770
PGCDGSGHVTGNYASHRSLSGCPRARKGGVKMTPTKEEKEDPELKCPVIGCDGQGHISGKYTSHRTASGC    771 - 840
PLAAKRQKENPLNGASLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQVIKKGKVSEELM    841 - 910
TIKLKATGGIESDEEIRHLDEEIKELNESNLKIEADMMKLQTQITSMESNLKTIEEENKLIEQNNESLLK    911 - 980
ELAGLSQALISSLADIQLPQMGPISEQNFEAYVNTLTDMYSNLERDYSPECKALLESIKQAVKGIHV       981 - 1047
//

Text Mined References (14)

PMID Year Title