Property Summary

NCBI Gene PubMed Count 104
PubMed Score 322.14
PubTator Score 166.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 2.500 2.0e-05
osteosarcoma -1.127 1.3e-02
Atopic dermatitis 1.100 2.3e-03
pancreatic ductal adenocarcinoma liver m... 1.419 7.7e-03
non-small cell lung cancer 1.376 1.2e-12
intraductal papillary-mucinous carcinoma... 1.600 3.9e-05
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-03
lung cancer 1.400 3.3e-04
pancreatic cancer 1.100 1.9e-05
interstitial cystitis -1.100 2.9e-04
lung adenocarcinoma 1.358 6.2e-05
ductal carcinoma in situ 1.800 1.6e-03
invasive ductal carcinoma 1.900 1.4e-02

Protein-protein Interaction (1)

Gene RIF (92)

PMID Text
26513078 Given that matriptase-1 participates in terminal KC differentiation, its absence in psoriatic skin lesions indicates that this contributes to the barrier disturbances in this disease.
26157007 Novel findings reveal a new paradigm in matriptase activation involving PDGF-D-specific signal transduction leading to extracellular acidosis.
25873032 Maritriptase is required for pro-HGF/c-Met signaling and cell proliferation in breast cancer cells.
25786220 Matriptase inhibition by HAI-2 requires the translocation of HAI-2 to the cell surface, a process which is observed in some breast cancer cells but not in mammary epithelial cells.
25730905 prostate cancer cell invasion is stimulated by a rapid but sustained increase in Src activity, mediated non-genomically by cytoplasmic AR, leading to rapid activation and shedding of the laminin protease Matriptase
24705933 Matriptase can act as a cellular sensor of the chemical environment of the cell that allows the cell to respond to and protect itself from changes in the chemical milieu.
24696092 Report potent/specific inhibition of matriptase by the cyclic microprotein MCoTI-II.
24617769 It presents evidence that matriptase efficiently cleaves the HR1 portion of gp41 into a 22-residue chemotactic peptide MAT-1, the sequence of which is highly conserved across HIV-1 clades.
24617769 Matriptase, a serine protease, efficiently cleaves the HR1 portion of HIV-1 gp41 into a 22-residue chemotactic peptide MAT-1, leading to chemotaxis by using FPR2 in primary neutrophils
24382204 Matriptase expression correlates with tumour progression and invasive capability in oral squamous cell carcinoma
24248283 higher expression of matriptase is an independent prognostic factor involved in the progression of esophageal squamous cell carcinoma (ESCC).
24070417 Dysregulated pericellular proteolysis as a result of unregulated matriptase expression with limited HAI-1 may contribute to the pathological characteristics of several human B-cell lymphomas.
24004857 matriptase expression and zymogen activation in hair follicles
23900022 Human matriptase may be involved in the regulation of keratinocyte growth and early differentiation, rather than terminal differentiation, providing mechanistic insights into the pathology of two congenital ichthyoses.
23673661 prostasin is a non-enzymatic co-factor for matriptase activation
23466486 High matriptase expression is associated with prostate cancer.
23443662 Prostasin requires expression of endogenous matriptase to stimulate barrier formation since matriptase depletion by siRNA silencing abrogates prostasin barrier-forming activity.
23443661 Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1
23365447 Authors identify and characterize matriptase as an influenza virus-activating protease capable of supporting multicycle viral replication in the human respiratory epithelium.
23248318 Emergent active matriptase is a functional biomarker of the transformed epithelium and that its proteolytic activity can be exploited to noninvasively evaluate tumorigenesis in vivo.
23192872 H9N2 viruses with R-S-S-R or R-S-R-R cleavage sites in hemagglutinin are activated by matriptase in addition to HAT and TMPRSS2 and, therefore, can be activated in a wide range of tissues what may affect virus spread, tissue tropism and pathogenicity.
23044656 Matriptase mRNA was detected in B-cell-derived Namalwa and Raji cells
22811538 matriptase has the ability to cleave HA directly or indirectly by activating HA-cleaving zymogens
22783993 Dsg-2 with a mutation at the predicted cleavage site is resistant to cleavage by matriptase. Thus Dsg-2 seems to be a functionally relevant physiological substrate of matriptase.
22582115 there is much more active prostasin than active matriptase on the apical and basolateral surfaces of airway epithelial cells
22514623 Matriptase protein expression was correlated with HER2 expression and highest expression was seen in HER2-positive cell lines, indicating a potential role in this subgroup.
22154938 A reverse binding motif that contributes to specific protease inhibition by antibodies.
22118498 we showed for the first time that MT1-MMP activates matriptase through the cleavage of HAI-1
22088470 Study provided the gene expression profile of HBV-related HCC and presented differential expression patterns of SATB-1, TM4SF-1 and ST-14 between cancerous and noncancerous tissues in patients with HBV-related HCC.
22081509 Matriptase protein and ST14 mRNA levels are significantly downregulated in inflamed colonic tissues from Crohn's disease and ulcerative colitis
22031598 These data suggest that matriptase activity can be rapidly inhibited by HAI-1 and other HAI-1-like protease inhibitors and "locked" in an inactive autoactivation intermediate, all of which places matriptase under very tight control.
21795523 The data suggested that normal epithelial cells use a dual mechanism involving hepatocyte growth factor activator inhibitor-1 and antithrombin to control matriptase and that the antithrombin-based mechanism is lost in the majority of carcinomas.
21678412 Expression of matriptase and prostasin is closely correlated in breast cancer cell lines and in breast cancer tissues. Matriptase and prostasin display a near identical spatial expression pattern in the epithelial compartment of breast cancer tissue.
21217780 matriptase as an initiator of c-Met-Akt-mTor-dependent signaling axis in tumors and mTor activation as an essential component of matriptase/c-Met-induced carcinogenesis
21148558 Transport via the transcytotic pathway makes prostasin available as a substrate for matriptase.
21123732 Although activated matriptase is not detected in normal epidermis, a dramatic increase is seen in keratinocytes at the site of inflammation in 16 different skin diseases.
21098708 Study unveiled a novel signaling axis of matriptase/PDGF-D/beta-PDGFR in PCa, providing new insights into functional interplay between serine protease and growth factor signaling networks.
21097670 Epithin, which regulates endothelial Tie2 functions, plays a critical role in the fine tuning of transendothelial migration for normal and cancer cells.
20971737 ErbB-2 signaling via the phosphatidylinositol 3-kinase pathway results in up-regulated matriptase zymogen activity, which contributes to prostate cancer cell invasion.
20716618 The ST14 variant rs704624 and protein expression of matriptase have prognostic significance in breast cancer.
20716618 Observational study of gene-disease association. (HuGE Navigator)
20696767 the matriptase-prostasin proteolytic cascade is tightly regulated by two mechanisms: 1) prostasin activation temporally coupled to matriptase autoactivation and 2) HAI-1 rapidly inhibiting not only active matriptase but also active prostasin
20652801 Soluble form of the protein secreted from cancer cells contains active angiogenic potential
20601429 matriptase is expressed in glioma cells and that matriptase specifically cleaves ASIC1 in heterologous expression systems.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20145119 MT-SP1 activity as a useful biomarker to visualize epithelial cancers using a noninvasive antibody-based method.
20142489 results support a key role for matriptase in regulating intestinal epithelial barrier competence, and suggest an intriguing link between pericellular serine protease activity and tight junction assembly in polarized epithelia
20015050 HGF is activated by the transmembrane serine proteases matriptase and hepsin, but not by the membrane-associated protease uPA.
19940125 Matriptase activation is an early cellular response to acidosis
19578749 matriptase may be involved in the progression of pancreatic ductal adenocarcinoma and that matriptase inhibition may contribute to preventing the progression of this devastating disease.
19546220 Findings suggest that ST14 plays an important role in several biological processes, and some effects are not completely dependent on miR-27b regulation.
19535514 Data suggest that the cellular location of matriptase activation and inhibition, and the secretory route for matriptase-HAI-1 complex may vary along with the functional divergence of different epithelial cells.
19443387 High matriptase expression in endometrial cancer may be associated with poor prognosis
19242518 PAR(2) is a substrate for matriptase in human skin in vivo; Deregulation of these proteins delineates squamous cell carcinoma progression
18843291 Ichthyosis, follicular atrophoderma, and hypotrichosis caused by mutations in ST14 is associated with impaired profilaggrin processing.
18813126 increase of matriptase observed for localized prostate cancers, whereas a decrease of matriptase expression is associated with prostate cancer progression.
18723439 Alpha1-antitrypsin (AAT), an endogenous inhibitor of serine proteases, inhibits the catalytic domain of human recombinant matriptase in vitro.
18713750 Unlike HAI-1 and matriptase, HAI-2 expression is detected in non-epithelial cells of brain and lymph nodes, suggesting that HAI-2 may also be involved in inhibition of serine proteases other than matriptase
18649738 The transient overexpression of MGAT5 significantly enhanced the activity of matriptase and the invasion ability in the LNCaP cells.
18649735 Overexpression of bikunin reduced the gene expression of matriptase, which attenuated in vitro cell invasion. Different metastatic characteristics between PC-3 and PC-J cells suggest that matriptase plays a role in the metastasis of prostate cancer.
18550704 Identification in human milk of complexes of matriptase with ATIII, A1AT, or A2AP, provides evidence that the proteolytic activity of matriptase, from cells that express no or low levels of HAI-1, may be controlled by secreted serpins.
18514224 The 2.2 A resolution crystal structure of an Fab antibody inhibitor in complex with the serine protease membrane-type serine protease 1 (MT-SP1/matriptase) reveals the molecular basis of its picomolar potency and specificity.
18274158 matriptase/HAI-1 ratios in poorly (1.8 +/- 0.4) and moderately differentiated (1.8 +/- 0.3) were significantly lower than in well differentiated (2.2 +/- 0.2) colorectal adenocarcinomas
18263585 the G827R mutation of matriptase in patients with autosomal recessive ichthyosis with hypotrichosis leads to the expression of an inactive protease
17981575 analysis of the regulation of matriptase and HAI-1 with an emphasis on the molecular mechanisms governing its zymogen activation, inhibition by HAI-1, and ectodomain shedding [review]
17981566 MT-SP1 is capable of playing roles in growth factor activation, receptor activation and inactivation, protease activation, and ectodomain shedding
17978729 mutation in the ST14 gene is associated with recessive autosomal ichthyosis with hypotrichosis
17940283 reduced activity of a matriptase-prostasin proteolytic cascade is the etiological origin of human ARIH and provides an important mouse model for the exploration of matriptase function in ARIH
17456594 overexpression of MSP, MT-SP1, and MST1R was a strong independent indicator of both metastasis and death in human breast cancer
17389401 MT-SP1 mediates extracellular signaling by regulating the local activation of the prometastatic growth factor MSP-1.
17344310 Autoactivation of matriptase requires protein-protein interactions but not active proteases.
17273967 Mutation in ST14 is associated with autosomal recessive ichthyosis with hypotrichosis
17228523 matriptase-1 plays a vital role in the aggressive nature and progression of prostate cancer
17131055 This review summarizes current knowledge about matriptase, its putative role in tumor initiation and progression, and its potential as a novel target in anti-cancer therapy.
16820046 results show that dysregulation of the matriptase/HAI-1 mRNA ratio occurs early during colorectal cancer carcinogenesis
16794252 down-regulation of matriptase expression in THP-1 cells by siRNA reduced the activation of cell-associated pro-uPA and the subsequent rapid initiation of plasminogen activation
16501837 Matriptase was overexpressed in all subtypes of renal cell carcinomas (RCC), and matriptase scores could distinguish between conventional clear cell RCC, GRCC, and SRCC.
16439987 Findings demonstrate for the first time that matriptase is overexpressed in many malignant ovarian tumors, and it may be a novel biomarker for diagnosis and treatment of malignant ovarian tumors.
16407223 analysis of ST14 domains and their point and deletion mutants
16353247 Significantly elevated levels of HAI-1 were detected in 38 patients with prostate cancer before any treatment.
16273651 The expressions of SNC19/matriptase and its inhibitor HAI-1 are decreased in gastrointestinal cancer tissues
16237759 SNC19/ST14 gene overexpression could enhance invasion of colorectal cancer cells in vitro significantly and influence early cell adherence to ECM, but could not change cell movement significantly.
16103220 dysregulated matriptase expression is implicated in malignant epithelial transformation in transgenic mice
15611789 TADG-15 is associated with early stage ovarian cancer and longer patient survival.
15200890 SNC19/ST14 could influence on the cell cytoskeletal protein (F-actin) organization and on cell adherence ability to extracellular matrix.
15075215 Actin cytoskeletal rearrangement is necessary but not sufficient for S1P-induced activation of matriptase at cell-cell contacts. Matriptase activation to adherens junction assembly and actin cytoskeletal rearrangement may control of matriptase activity.
14747469 matriptase is downregulated through suppression of activation of receptor-bound pro-urokinase, and leads to inhibition of tumor invasion
14584072 Cervical carcinoma cells expressed high levels of TADG-15, suggesting that this protease may play an important role in invasion and metastasis.
12738778 besides matriptase catalytic activity, matriptase activation requires post-translational modification of the protease, intact noncatalytic domains, and its cognate inhibitor
12498394 examined the regulation of activation of matriptase in human breast cancer cells
11864986 Prometastatic effect of N-acetylglucosaminyltransferase V is due to modification and stabilization of active matriptase by adding beta 1-6 GlcNAc branching
11792696 Sphingosine 1-phosphate, present in serum-derived lipoproteins, activates matriptase

AA Sequence

MGSDRARKGGGGPKDFGAGLKYNSRHEKVNGLEEGVEFLPVNNVKKVEKHGPGRWVVLAAVLIGLLLVLL      1 - 70
GIGFLVWHLQYRDVRVQKVFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKE     71 - 140
SAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVMLPPRARSLKSFVVTSVVAFPTDSKTVQRTQ    141 - 210
DNSCSFGLHARGVELMRFTTPGFPDSPYPAHARCQWALRGDADSVLSLTFRSFDLASCDERGSDLVTVYN    211 - 280
TLSPMEPHALVQLCGTYPPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGT    281 - 350
FNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKDYVEINGEKYCGERSQFVVTS    351 - 420
NSNKITVRFHSDQSYTDTGFLAEYLSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDHSDELNCSCDA    421 - 490
GHQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSNGKCLSKSQQCNGKDDCGDGSDEASCP    491 - 560
KVNVVTCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQV    561 - 630
SLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISH    631 - 700
PFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRV    701 - 770
INQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYT    771 - 840
RLPLFRDWIKENTGV                                                           841 - 855
//

Text Mined References (106)

PMID Year Title
26513078 2015 Matriptase-1 expression is lost in psoriatic skin lesions and is downregulated by TNF? in vitro.
26157007 2016 Matriptase activation and shedding through PDGF-D-mediated extracellular acidosis.
25873032 2015 Targeting matriptase in breast cancer abrogates tumour progression via impairment of stromal-epithelial growth factor signalling.
25786220 2015 Differential subcellular localization renders HAI-2 a matriptase inhibitor in breast cancer cells but not in mammary epithelial cells.
25730905 2015 Androgen receptor non-nuclear regulation of prostate cancer cell invasion mediated by Src and matriptase.
24705933 2014 Matriptase autoactivation is tightly regulated by the cellular chemical environments.
24696092 2014 Potent and specific inhibition of the biological activity of the type-II transmembrane serine protease matriptase by the cyclic microprotein MCoTI-II.
24617769 2014 The HIV-1 gp41 ectodomain is cleaved by matriptase to produce a chemotactic peptide that acts through FPR2.
24382204 2014 Expression of matriptase correlates with tumour progression and clinical prognosis in oral squamous cell carcinoma.
24248283 2014 Overexpression of matriptase correlates with poor prognosis in esophageal squamous cell carcinoma.
24070417 2013 Imbalanced matriptase pericellular proteolysis contributes to the pathogenesis of malignant B-cell lymphomas.
24004857 2014 Matriptase expression and zymogen activation in human pilosebaceous unit.
23900022 2014 Matriptase regulates proliferation and early, but not terminal, differentiation of human keratinocytes.
23673661 2013 A matriptase-prostasin reciprocal zymogen activation complex with unique features: prostasin as a non-enzymatic co-factor for matriptase activation.
23466486 2013 Curcumin-targeting pericellular serine protease matriptase role in suppression of prostate cancer cell invasion, tumor growth, and metastasis.
23443662 2013 Prostasin is required for matriptase activation in intestinal epithelial cells to regulate closure of the paracellular pathway.
23443661 2013 Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23365447 2013 Matriptase proteolytically activates influenza virus and promotes multicycle replication in the human airway epithelium.
23248318 2013 Imaging a functional tumorigenic biomarker in the transformed epithelium.
23192872 2013 Matriptase, HAT, and TMPRSS2 activate the hemagglutinin of H9N2 influenza A viruses.
23044656 2013 Matriptase is highly upregulated in chronic lymphocytic leukemia and promotes cancer cell invasion.
22811538 2012 Cleavage activation of the human-adapted influenza virus subtypes by matriptase reveals both subtype and strain specificities.
22783993 2012 From prediction to experimental validation: desmoglein 2 is a functionally relevant substrate of matriptase in epithelial cells and their reciprocal relationship is important for cell adhesion.
22582115 2012 Activity and inhibition of prostasin and matriptase on apical and basolateral surfaces of human airway epithelial cells.
22514623 2012 Diversity of matriptase expression level and function in breast cancer.
22154938 2012 A reverse binding motif that contributes to specific protease inhibition by antibodies.
22118498 2012 Cleavage of hepatocyte growth factor activator inhibitor-1 by membrane-type MMP-1 activates matriptase.
22088470 2011 Genomics of hepatitis B virus-related hepatocellular carcinoma and adjacent noncancerous tissues with cDNA microarray.
22081509 2012 Matriptase protects against experimental colitis and promotes intestinal barrier recovery.
22031598 2012 Mechanisms for the control of matriptase activity in the absence of sufficient HAI-1.
21795523 2011 Matriptase is inhibited by extravascular antithrombin in epithelial cells but not in most carcinoma cells.
21678412 2012 Strong expression association between matriptase and its substrate prostasin in breast cancer.
21269460 2011 Initial characterization of the human central proteome.
21217780 2011 c-Met-induced epithelial carcinogenesis is initiated by the serine protease matriptase.
21148558 2011 Transport via the transcytotic pathway makes prostasin available as a substrate for matriptase.
21123732 2011 Increased matriptase zymogen activation in inflammatory skin disorders.
21098708 2010 A novel signaling axis of matriptase/PDGF-D/ß-PDGFR in human prostate cancer.
21097670 2011 Epithin/PRSS14 proteolytically regulates angiopoietin receptor Tie2 during transendothelial migration.
20971737 2010 Matriptase is involved in ErbB-2-induced prostate cancer cell invasion.
20716618 2010 ST14 gene variant and decreased matriptase protein expression predict poor breast cancer survival.
20696767 2010 Regulation of the matriptase-prostasin cell surface proteolytic cascade by hepatocyte growth factor activator inhibitor-1 during epidermal differentiation.
20652801 2010 Soluble epithin/PRSS14 secreted from cancer cells contains active angiogenic potential.
20601429 2010 Proteolytic cleavage of human acid-sensing ion channel 1 by the serine protease matriptase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20145119 2010 Tumor detection by imaging proteolytic activity.
20142489 2010 Membrane-anchored serine protease matriptase regulates epithelial barrier formation and permeability in the intestine.
20015050 2010 Pericellular activation of hepatocyte growth factor by the transmembrane serine proteases matriptase and hepsin, but not by the membrane-associated protease uPA.
19940125 2010 Matriptase activation, an early cellular response to acidosis.
19911255 2010 Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor.
19578749 2009 Use of IHC and newly designed matriptase inhibitors to elucidate the role of matriptase in pancreatic ductal adenocarcinoma.
19546220 2009 ST14 (suppression of tumorigenicity 14) gene is a target for miR-27b, and the inhibitory effect of ST14 on cell growth is independent of miR-27b regulation.
19535514 2009 Polarized epithelial cells secrete matriptase as a consequence of zymogen activation and HAI-1-mediated inhibition.
19443387 2009 Expression of matriptase and clinical outcome of human endometrial cancer.
19242518 2009 Role of matriptase and proteinase-activated receptor-2 in nonmelanoma skin cancer.
18843291 2009 Ichthyosis, follicular atrophoderma, and hypotrichosis caused by mutations in ST14 is associated with impaired profilaggrin processing.
18813126 2009 Protein expression of matriptase and its cognate inhibitor HAI-1 in human prostate cancer: a tissue microarray and automated quantitative analysis.
18723439 2008 Alpha1-antitrypsin inhibits the activity of the matriptase catalytic domain in vitro.
18713750 2008 Potent inhibition and global co-localization implicate the transmembrane Kunitz-type serine protease inhibitor hepatocyte growth factor activator inhibitor-2 in the regulation of epithelial matriptase activity.
18649738 Evaluating the function of matriptase and N-acetylglucosaminyltransferase V in prostate cancer metastasis.
18649735 Down-regulation of matriptase by overexpression of bikunin attenuates cell invasion in prostate carcinoma cells.
18550704 2008 Purification from human milk of matriptase complexes with secreted serpins: mechanism for inhibition of matriptase other than HAI-1.
18514224 2008 Structure of an Fab-protease complex reveals a highly specific non-canonical mechanism of inhibition.
18274158 2007 Decreased matriptase/HAI-1 ratio in advanced colorectal adenocarcinoma of Chinese patients.
18263585 2008 Mutation G827R in matriptase causing autosomal recessive ichthyosis with hypotrichosis yields an inactive protease.
17981575 2008 Zymogen activation, inhibition, and ectodomain shedding of matriptase.
17981566 2008 MT-SP1 proteolysis and regulation of cell-microenvironment interactions.
17978729 2007 [Recessive autosomal ichthyosis with hypotrichosis with mutation in the ST14 gene].
17940283 2007 Autosomal ichthyosis with hypotrichosis syndrome displays low matriptase proteolytic activity and is phenocopied in ST14 hypomorphic mice.
17456594 2007 The macrophage-stimulating protein pathway promotes metastasis in a mouse model for breast cancer and predicts poor prognosis in humans.
17389401 2007 Coordinate expression and functional profiling identify an extracellular proteolytic signaling pathway.
17344310 2007 Autoactivation of matriptase in vitro: requirement for biomembrane and LDL receptor domain.
17273967 2007 Autosomal recessive ichthyosis with hypotrichosis caused by a mutation in ST14, encoding type II transmembrane serine protease matriptase.
17228523 2006 Genetic reduction of matriptase-1 expression is associated with a reduction in the aggressive phenotype of prostate cancer cells in vitro and in vivo.
17131055 2006 Matriptase and its putative role in cancer.
16820046 2006 The ratio of Matriptase/HAI-1 mRNA is higher in colorectal cancer adenomas and carcinomas than corresponding tissue from control individuals.
16794252 2006 Initiation of plasminogen activation on the surface of monocytes expressing the type II transmembrane serine protease matriptase.
16501837 2006 Expression of serine protease matriptase in renal cell carcinoma: correlation of tissue microarray immunohistochemical expression analysis results with clinicopathological parameters.
16439987 2006 Increasing expression of serine protease matriptase in ovarian tumors: tissue microarray analysis of immunostaining score with clinicopathological parameters.
16407223 2006 Protein interaction analysis of ST14 domains and their point and deletion mutants.
16353247 2006 Serum hepatocyte growth factor activator inhibitor type I (HAI-I) and type 2 (HAI-2) in prostate cancer.
16341674 2005 Transcriptome analysis of human gastric cancer.
16273651 2005 Expression of serine protease SNC19/matriptase and its inhibitor hepatocyte growth factor activator inhibitor type 1 in normal and malignant tissues of gastrointestinal tract.
16237759 2005 Effect of SNC19/ST14 gene overexpression on invasion of colorectal cancer cells.
16103220 2005 Deregulated matriptase causes ras-independent multistage carcinogenesis and promotes ras-mediated malignant transformation.
16007225 2005 Adhesion signaling by a novel mitotic substrate of src kinases.
15611789 2005 Transmembrane serine protease TADG-15 (ST14/Matriptase/MT-SP1): expression and prognostic value in ovarian cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15200890 2004 [SNC19/ST14 gene transfection and expression influence the biological behavior of colorectal cancer cells].
15075215 2004 Assembly of adherens junctions is required for sphingosine 1-phosphate-induced matriptase accumulation and activation at mammary epithelial cell-cell contacts.
14747469 2004 Inhibition of tumor invasion by genomic down-regulation of matriptase through suppression of activation of receptor-bound pro-urokinase.
14584072 2003 The novel serine protease tumor-associated differentially expressed gene-15 (matriptase/MT-SP1) is highly overexpressed in cervical carcinoma.
12738778 2003 The activation of matriptase requires its noncatalytic domains, serine protease domain, and its cognate inhibitor.
12498394 2002 Deregulated activation of matriptase in breast cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372819 2002 Unusual proteolytic activation of pro-hepatocyte growth factor by plasma kallikrein and coagulation factor XIa.
11864986 2002 Prometastatic effect of N-acetylglucosaminyltransferase V is due to modification and stabilization of active matriptase by adding beta 1-6 GlcNAc branching.
11696548 2002 Catalytic domain structures of MT-SP1/matriptase, a matrix-degrading transmembrane serine proteinase.
11290548 2001 Matriptase and HAI-1 are expressed by normal and malignant epithelial cells in vitro and in vivo.
11125283 Ovarian tumor cells express a transmembrane serine protease: a potential candidate for early diagnosis and therapeutic intervention.
10962009 2000 Activation of hepatocyte growth factor and urokinase/plasminogen activator by matriptase, an epithelial membrane serine protease.
10831593 2000 Cellular localization of membrane-type serine protease 1 and identification of protease-activated receptor-2 and single-chain urokinase-type plasminogen activator as substrates.
10500122 1999 Reverse biochemistry: use of macromolecular protease inhibitors to dissect complex biological processes and identify a membrane-type serine protease in epithelial cancer and normal tissue.
10373425 1999 Purification and characterization of a complex containing matriptase and a Kunitz-type serine protease inhibitor from human milk.
10373424 1999 Molecular cloning of cDNA for matriptase, a matrix-degrading serine protease with trypsin-like activity.
9925927 1998 Assignment1 of human putative tumor suppressor genes ST13 (alias SNC6) and ST14 (alias SNC19) to human chromosome bands 22q13 and 11q24-->q25 by in situ hybridization.