Property Summary

NCBI Gene PubMed Count 42
PubMed Score 75.62
PubTator Score 646.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.513 7.6e-03
Multiple myeloma 1.296 3.6e-03
oligodendroglioma 1.100 3.5e-02
pancreatic ductal adenocarcinoma liver m... -1.597 1.6e-02
invasive ductal carcinoma -1.038 9.5e-04
ovarian cancer -2.600 1.0e-08
Down syndrome 1.200 2.8e-03

Gene RIF (14)

PMID Text
25616159 A novel susceptibility gene, ST13, coding for a cochaperone of the glucocorticoid receptor, is associated with exacerbations in asthmatic children and young adults despite their ICS use.
23125081 St13 is a proliferation regulator that inhibits tumor growth in colorectal neoplasms and may affect cell migration.
21767636 Akt phosphorylation at Thr308 and Ser473 is required for CHIP-mediated ubiquitination of the kinase.
21728385 Hip has been identified as a novel substrate of GRK5 in vitro and in cells, and phosphorylation of Hip by GRK5 plays a role in modulating CXCR4 internalization
21240662 A single amino acid substitution (L211S) resulted in a loss of Hip function. This mutation also appears to disrupt the interaction of Hip with Hsp70 in vitro
20534503 S-nitrosoglutathione corrects DeltaF508 CFTR trafficking by inhibiting Hop expression
20512919 These results strongly indicate ST13 mediated by adenovirus triggers colorectal cell apoptosis via ASK1-JNK signaling cascade
20193743 The expression levels of ST13 cannot serve as a biomarker for early stages of PD.
17535810 analysis of similarity between the chloroplast translocon component, Tic40, and the human co-chaperone, Hsp70-interacting protein
17013759 results suggest that granzyme B-mediated loss of HIP expression occurs in vivo, and in a coordinate fashion with loss of BID, pro-caspase-8 and pro-caspase-3; data implicate the Hsp70 co-chaperone HIP in the proteolytic cascade of some apoptotic pathways
16358374 The expression levels of the ST13 gene were significantly decreased in primary tumors compared with adjacent mucosa (P<0.05).
15845543 tetratricopeptide repeat domain is required for effects of CHIP on alpha-synuclein inclusion morphology, number of inclusions, and proteasomal degradation as well as the direct interaction of CHIP with Hsp70 implicates their cooperation in these processes
15637739 The expression of ST13 decreases in colorectal cancer tissue compared with that in adjacent normal tissue. ST13 is mostly expressed in colorectal epithelia and adenocarcinoma cells.
15071092 Hip functions to promote the efficiency of glucocorticoid receptor maturation in cells

AA Sequence

MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK      1 - 70
ADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDA     71 - 140
IKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACK    141 - 210
LDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGS    211 - 280
FPGGFPGGMPGNFPGGMPGMGGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQS    281 - 350
NPKVMNLISKLSAKFGGQA                                                       351 - 369
//

Text Mined References (44)

PMID Year Title
25616159 2015 ST13 polymorphisms and their effect on exacerbations in steroid-treated asthmatic children and young adults.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23125081 2012 ST13, a proliferation regulator, inhibits growth and migration of colorectal cancer cell lines.
21767636 2011 Akt phosphorylation at Thr308 and Ser473 is required for CHIP-mediated ubiquitination of the kinase.
21728385 2011 G protein-coupled receptor kinase 5 phosphorylation of hip regulates internalization of the chemokine receptor CXCR4.
21240662 2011 Single-point mutation in a conserved TPR domain of Hip disrupts enhancement of glucocorticoid receptor signaling.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
20534503 2010 Hsp 70/Hsp 90 organizing protein as a nitrosylation target in cystic fibrosis therapy.
20512919 2010 ASK1-JNK signaling cascade mediates Ad-ST13-induced apoptosis in colorectal HCT116 cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20193743 2010 Expression analysis of suppression of tumorigenicity 13 gene in patients with Parkinson's disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17535810 2007 Functional similarity between the chloroplast translocon component, Tic40, and the human co-chaperone, Hsp70-interacting protein (Hip).
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17013759 2006 Proteolysis of HIP during apoptosis occurs within a region similar to the BID loop.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16358374 2005 Evaluation of ST13 gene expression in colorectal cancer patients.
15845543 2005 The co-chaperone carboxyl terminus of Hsp70-interacting protein (CHIP) mediates alpha-synuclein degradation decisions between proteasomal and lysosomal pathways.
15664198 2005 Human Asf1 regulates the flow of S phase histones during replicational stress.
15637739 2005 Expression of ST13 in colorectal cancer and adjacent normal tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15071092 2004 The heat shock protein 70 cochaperone hip enhances functional maturation of glucocorticoid receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751889 2002 Hsc/Hsp70 interacting protein (hip) associates with CXCR2 and regulates the receptor signaling and trafficking.
11741305 2001 The carboxyl-terminal lobe of Hsc70 ATPase domain is sufficient for binding to BAG1.
11687574 2002 Domain structure of the HSC70 cochaperone, HIP.
11559757 2001 A molecular chaperone complex at the lysosomal membrane is required for protein translocation.
10781595 2000 The molecular chaperones Hsp90 and Hsc70 are both necessary and sufficient to activate hormone binding by glucocorticoid receptor.
10702249 2000 The Hsp organizer protein hop enhances the rate of but is not essential for glucocorticoid receptor folding by the multiprotein Hsp90-based chaperone system.
10591208 1999 The DNA sequence of human chromosome 22.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9925927 1998 Assignment1 of human putative tumor suppressor genes ST13 (alias SNC6) and ST14 (alias SNC19) to human chromosome bands 22q13 and 11q24-->q25 by in situ hybridization.
9857057 1998 Hop as an adaptor in the heat shock protein 70 (Hsp70) and hsp90 chaperone machinery.
9594214 1997 Screening and identification of down-regulated genes in colorectal carcinoma by subtractive hybridization: a method to identify putative tumor suppressor genes.
9452498 1998 Hop modulates Hsp70/Hsp90 interactions in protein folding.
9387309 1996 [Differential expression of HSU17714 gene in colorectal cancer and normal colonic mucosa].
9292708 1997 Characterization of colorectal-cancer-related cDNA clones obtained by subtractive hybridization screening.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8887650 1996 Mutational analysis of the hsp70-interacting protein Hip.
8721986 1996 Molecular cloning of human p48, a transient component of progesterone receptor complexes and an Hsp70-binding protein.