Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.17
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03

Expression

AA Sequence

MNGDDAFAKRPRDDAKASEKRSKAFDDIAKYFSKEEWEKMKFSEKISCVHMKRKYEAMTKLGFNVTLSLF      1 - 70
MRNKRATDSQRNDSDNDRNRGNEVERPQMTFGRLQRIIPKIMPEKPAEEGSDSKGVPEASGPQNDGKKLC     71 - 140
PPGKASSSEKIHERSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDK                          141 - 188
//

Text Mined References (5)

PMID Year Title
17117414 2007 The (epi)genetics of human synovial sarcoma.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12216073 2002 The SSX gene family: characterization of 9 complete genes.
11107170 2001 Molecular mechanisms underlying human synovial sarcoma development.