Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.53
PubTator Score 6.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Synovial sarcoma 25 4.309 2.2

Gene RIF (1)

PMID Text
16546222 Two kinds of cancer-testis antigen, SSX-2 and SSX-5 showed high-specific and high-frequent expression in hepatocellular carcinoma tissues, but neither of them could be detected in adjacent non-HCC tissues.

AA Sequence

MNGDDAFVRRPRVGSQIPEKMQKAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPF      1 - 70
MRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLR     71 - 140
PSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE                          141 - 188
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21880588 2011 Expression and immunotherapeutic targeting of the SSX family of cancer-testis antigens in prostate cancer.
17023585 2007 Cancer-testis antigens are commonly expressed in multiple myeloma and induce systemic immunity following allogeneic stem cell transplantation.
16546222 2006 Expression of cancer-testis antigen (CTA) in tumor tissues and peripheral blood of Chinese patients with hepatocellular carcinoma.
16224274 SSX cancer testis antigens are expressed in most multiple myeloma patients: co-expression of SSX1, 2, 4, and 5 correlates with adverse prognosis and high frequencies of SSX-positive PCs.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12216073 2002 The SSX gene family: characterization of 9 complete genes.
12007189 2002 The cancer-related protein SSX2 interacts with the human homologue of a Ras-like GTPase interactor, RAB3IP, and a novel nuclear protein, SSX2IP.
11179834 2001 Expressions of cancer-testis antigens in human hepatocellular carcinomas.
11107170 2001 Molecular mechanisms underlying human synovial sarcoma development.
10749136 2000 Heterogeneous expression of the SSX cancer/testis antigens in human melanoma lesions and cell lines.
9688183 1998 Detection of the SYT-SSX fusion transcripts in formaldehyde-fixed, paraffin-embedded tissue: a reverse transcription polymerase chain reaction amplification assay useful in the diagnosis of synovial sarcoma.
9378559 1997 SSX: a multigene family with several members transcribed in normal testis and human cancer.