Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.96
PubTator Score 4.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 6.0e-05
Disease Target Count Z-score Confidence
Synovial sarcoma 25 4.091 2.0

Gene RIF (1)

PMID Text
24645645 SSX2, SSX3, and SSX4 are expressed only in 3.5% early-stage non-small cell lung cancer patients.

AA Sequence

MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSF      1 - 70
MRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLC     71 - 140
PPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE                          141 - 188
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24645645 2014 SSX2-4 expression in early-stage non-small cell lung cancer.
20946665 2010 A multigene predictor of metastatic outcome in early stage hormone receptor-negative and triple-negative breast cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12216073 2002 The SSX gene family: characterization of 9 complete genes.
12007189 2002 The cancer-related protein SSX2 interacts with the human homologue of a Ras-like GTPase interactor, RAB3IP, and a novel nuclear protein, SSX2IP.
10749136 2000 Heterogeneous expression of the SSX cancer/testis antigens in human melanoma lesions and cell lines.
9378559 1997 SSX: a multigene family with several members transcribed in normal testis and human cancer.
8697803 1996 A novel Krüppel-associated box containing the SSX gene (SSX3) on the human X chromosome is not implicated in t(X;18)-positive synovial sarcomas.