Property Summary

NCBI Gene PubMed Count 92
PubMed Score 116.16
PubTator Score 179.29

Knowledge Summary

Patent (12,063)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 6.0e-04

 OMIM Phenotype (1)

Gene RIF (73)

PMID Text
26474434 Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
25962406 An immunohistochemical investigation of the expression of somatostatin receptor subtypes
25925002 SSTR2 and SSTR5 protein levels were induced as compared to any agent alone.
25854304 This is the first evidence indicating that sst5TMD4 is expressed in human medullary thyroid carcinoma cells, where it associates with more aggressive behavior, suggesting that sst5TMD4 might play a functionally relevant role.
25808161 Data indicate that somatostatin receptor scintigraphy (SRS) and immunohistochemical results for somatostatin and dopamine receptors sstr2, sstr3, sstr5 and D2R were compared in neuroendocrine neoplasms tissues.
25765179 Somatostatin receptors were expressed in a high proportion of merkel cell carcinomas, although expression was heterogeneous between tumours and was not associated with disease severity.
25637790 A truncated sst5-variant (sst5TMD4) can influence the secretory response of somatotropinomas to somatostatin analogues-therapy.
25008035 SSTR5 was the predominantly expressed receptor subtype in the cytoplasm of all GH-secreting adenomas tested, regardless of whether they came from octreotide-naive, octreotide-responsive, or octreotide-resistant patients. SSTR5 mRNA predominance was significant only in octreotide treated patients. Its expression was not correlated with baseline or post-octreotide GH or IGF-1 levels or tumor volume.
24967740 SSTR 5 was shown to be the main receptor subtype in the analysed differentiated or anaplastic thyroid malignancies, whereas SSTR 2 was found only in a small percentage.
24634938 Tumor cells in the tissue samples of the patients diagnosed with advanced-stage hepatocellular carcinoma expressed a high proportion of SSTR1 and SSTR5.
24465589 SSTR5 protein is overexpressed in poorly differentiated thyroid cancer and may be involved in the lack of response to somatostatin analogue treatment.
24189142 Whereas sst2 receptors might play a primary role in the differentiation and regulation of TSH, LH, and FSH cells, sst5 receptors appear to be mainly involved in GH regulation from birth onward
24182563 We studied the expression of SSTR(2A) and SSTR(5) with new procedures in 108 pituitary tumors
23991955 High SSTR5 expression is associated with gallbladder cancer.
23418396 agonist-selective phosphorylation of carboxyl-terminal Threonine 333 of Sst5, is reported.
22770972 Except for SSTR5, all SSTRs showed a tendency toward decreased expression in well-to poorly differentiated neuroendocrine carcinoma of the lung.
22640914 Report down-regulation of SSTR-5 expression in operable hepatocellular carcinomas.
22419713 Determination of the expression of SSTR5 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas.
21952553 The rabbit monoclonal antibodies UMB-4 and UMB-1 will facilitate the assessment of the somatostatin receptor status of human tumors during routine histopathological examinations.
21820437 ZDHHC5 and SSTR5 are colocalized at the plasma membrane and coexpression of ZDHHC5 increased palmitoylation of SSTR5 whereas knock-down of endogenous ZDHHC5 by siRNAs decreased it.
21810856 Our results demonstrate a previously undetected strong association of two SSTR5 single nucleotide polymorphisms with acromegaly
21692047 data suggest that SSTR5 genetic variants play a role in pancreatic cancer development and progression
21667819 we investigated expression of SSTR2 and SSTR5 in the human thoracic duct
21503779 mRNA levels of SSTR2a, SSTR3 and SSTR5 in neuroendocrine lung cancer affected patients, were determined
21419811 demonstrate that cells transfected with SSTR1 or SSTR1/5 negatively regulates EGF mediated effects attributed to the inhibition of EGFR phosphorylation.
21383526 differential gene expression profiles revealed more abundant mRNA expression in ectopic ACTH syndrome than in Cushing disease of SSTR-5
21249361 SSTR5 P335L is a hypofunctional protein with a potentially harmful effect on function, as well as potential latent effect, and therefore it could affect the clinical response to somatostatin analog therapy for patients with pancreatic cancer.
21238583 The heterodimerization of somatostatin receptor-5 not only indicate the receptor's specificity of interaction but also provide new insight to understand the molecular mechanism in regulation of signaling pathway in receptor specific manner.
21190959 These data indicate that the activation and/or overexpression of SST receptors along with the inhibition of EGFR will serve as an important therapeutic approach in the treatment of ErbB-positive tumors.
20810604 Common genetic variation in the IGF1 and SSTR5 genes seems to influence circulating IGF-I levels
20810604 Observational study of gene-disease association. (HuGE Navigator)
20739383 Overexpressed in endomterium inendometriosis.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20717067 Data show that the mRNA levels of SSTR1, SSTR2, SSTR3, and SSTR5 were high in PET compared with AC, whereas the expression of SSTR4 was low in PET and AC.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20529830 The summarized expression pattern of SSTR in the investigated neuroendocrine tumors in our material was: SSTR 1> SSTR 5> SSTR 3> SSTR 2A> SSTR 2B.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20233783 Potential role of SSTR5 in the response of some tumors to somatostatin receptors.
20207824 importance of Asn13 and/or Asn26 residues in the agonist-specific signalling of hSSTR5
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20182388 Studies show that this study may be the basis for further functional studies to evaluate the role of somatostatin receptors sst1 to sst5 in the diabetic state.
20150960 SSTR5 and CCR7 have a role in Crohn's disease pathogenesis
19894022 This study demonstrated negative immunoreactivity for SSTR-5 in the adenomatous tissue.
19748526 heterodimerisation between hSSTR2 and hSSTR5 is potentiated in the absence of receptor-stimulation
19423539 Genetic variation in the SSTR5 gene and, particularly, the rs4988483 single nucleotide polymorphism influence circulating IGFI and IGFBP3 hormone levels with no measurable effect on prostate cancer risk.
19423539 Observational study of gene-disease association. (HuGE Navigator)
19401364 The existence of two previously unidentified sst5 spliced variants with distinct distribution in normal tissues and pituitary tumors.
19342453 investigation of the role of BBXXB and DRY motifs of SST5 in the transduction of intracellular signals involved in the regulation of GH secretion and cell proliferation
19330452 In somatotrophinomas patients treated with somatostatin analogs, the most expressed SSTR was SSTR5, SSTR3, SSTR2, SSTR1, and SSTR4, respectively.
19318729 SSTR5 mRNA levels in Cushing disease were greater than silent corticotroph adenoma (SCA) but did not differ between non-functioning pituitary tumor and SCA.
19070659 To the best of our knowledge, this is the first report describing crosstalk/interactions between SSTRs and ErbBs.
18936524 Immunohistochemistry stufy of SSTR5 in prostate tissue from patients with bladder outlet obstruction showed that close to 90% of secretory cells showed a weak positivity in the cytoplasm.
18653781 Data show that human somatostatin receptors (SSTR)2 and SSTR5 heterodimerize, and that selective activation of SSTR2 and not SSTR5, or their costimulation, modulates the association.
18066572 The majority of all benign, premalignant and malignant laryngeal specimens expressed moderate to high levels of expression of SSTR5.
17159301 The expression of SSTR5 in TSHoma may be a useful marker for predicting the outcome of octreotide therapy.
16954443 Cytostatic action exerted by SSTR2 analogs might account for the tumor shrinkage observed in acromegalic patients treated with long-acting somatostatin analogs.
16690617 nNOS is a new p60(src) kinase substrate essential for SST5-mediated anti-proliferative action
16216913 Results suggest that the expression pattern of dopamine receptor 2 and somatostatin receptor 5 may influence the effects of SRIF analogs in growth hormone-secreting pituitary adenomas.
16214911 Observational study of gene-disease association. (HuGE Navigator)
16012170 intracellular sorting of the somatostatin receptor subtype 5 is regulated by interactions with PDZ domain proteins PIST/GOPC and PDZK1
15914528 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15914528 role for SSTR5 t-461c and c1004t alleles in influencing GH and IGF-I levels in patients with acromegaly, whereas SSTR2 and SSTR5 variants seem to have a minor role in determining the responsiveness to somatostatin analogs
15247250 activation of hSSTR5 but not hSSTR1 is necessary for heterodimeric assembly
15118275 The degree (or level) of sst2 and sst5 expression is critical for the ultimate GH response of somatotropinomas to endogenous SRIF tone and exogenous SRIF analogue therapy.
14602773 Sst2 and sst5 were expressed in 70%, sst1 in 50%, and sst3 and sst4 subtypes only in 15-20% of insulinomas
12898583 Results do not suggest the SSTR5 gene as a susceptibility gene for autism
12414882 somatostatin receptor transcripts were found in lymphocytes both from Graves' ophthalmopathy retroorbital tissues and blood samples, with levels of expression of SST1, -2, and -4 mRNA higher than those of the SST3 and -5 transcripts
12192619 Observational study of gene-disease association. (HuGE Navigator)
12192619 the SSTR5 gene is involved in the etiology of bipolar affective disorder or may exist in linkage disequilibrium with a susceptibility gene close to SSTR5.
12072395 identified an upstream promoter of the somatostatin receptor 5 gene with tissue-specific activity
12021920 SSTRs 1-5 are heterogeneously expressed in gastroenteropancreatic endocrine tumors
11753241 SSTR transcripts are expressed and functional in retroorbital fibroblasts. SSTR1 is expressed in Grave's disease and octreotide inhibits retroorbital cell growth, explaining the SRIH therapeutic effect.

AA Sequence

MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAK      1 - 70
MKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLA     71 - 140
VVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGF    141 - 210
FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEP    211 - 280
ASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPA    281 - 350
HRAAANGLMQTSKL                                                            351 - 364
//

Text Mined References (93)

PMID Year Title
26474434 2016 Prognostic Value of Somatostatin Receptor Subtypes in Pancreatic Neuroendocrine Tumors.
25962406 2015 An immunohistochemical investigation of the expression of somatostatin receptor subtypes - should therapeutic trials be performed to determine the efficacy of somatostatin analogs in treating advanced thyroid malignances?
25925002 2015 Docetaxel in combination with octreotide shows synergistic apoptotic effect by increasing SSTR2 and SSTR5 expression levels in prostate and breast cancer cell lines.
25854304 2015 The expression of the truncated isoform of somatostatin receptor subtype 5 associates with aggressiveness in medullary thyroid carcinoma cells.
25808161 2015 Somatostatin and dopamine receptor expression in neuroendocrine neoplasms: correlation of immunohistochemical findings with somatostatin receptor scintigraphy visual scores.
25765179 2015 Somatostatin Receptors 2A and 5 Are Expressed in Merkel Cell Carcinoma with No Association with Disease Severity.
25637790 2015 Truncated somatostatin receptor variant sst5TMD4 confers aggressive features (proliferation, invasion and reduced octreotide response) to somatotropinomas.
25008035 2014 Cytoplasmic expression of SSTR2 and 5 by immunohistochemistry and by RT/PCR is not associated with the pharmacological response to octreotide.
24967740 2014 Expression of somatostatin receptor subtype 2 and subtype 5 in thyroid malignancies.
24634938 2013 Somatostatin receptor 1 (SSTR1) and somatostatin receptor 5 (SSTR5)expression in hepatocellular carcinoma.
24465589 2014 The truncated isoform of somatostatin receptor5 (sst5TMD4) is associated with poorly differentiated thyroid cancer.
24189142 2014 Somatostatin receptors type 2 and 5 expression and localization during human pituitary development.
24182563 2014 Expression of somatostatin receptors, SSTR2A and SSTR5, in 108 endocrine pituitary tumors using immunohistochemical detection with new specific monoclonal antibodies.
23991955 2013 Somatostatin receptors 3, 4 and 5 play important roles in gallbladder cancer.
23418396 2013 Phosphorylation of threonine 333 regulates trafficking of the human sst5 somatostatin receptor.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
22770972 2012 Differential expression of somatostatin receptors 1-5 in neuroendocrine carcinoma of the lung.
22640914 2012 Characterization of somatostatin receptor 2 and 5 expression in operable hepatocellular carcinomas.
22419713 2012 Expression of Ki-67, PTTG1, FGFR4, and SSTR 2, 3, and 5 in nonfunctioning pituitary adenomas: a high throughput TMA, immunohistochemical study.
21952553 2011 Reassessment of sst(5) somatostatin receptor expression in normal and neoplastic human tissues using the novel rabbit monoclonal antibody UMB-4.
21820437 2011 Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase.
21810856 2011 Identification of somatostatin receptor type 5 gene polymorphisms associated with acromegaly.
21692047 2011 Association between somatostatin receptor 5 gene polymorphisms and pancreatic cancer risk and survival.
21667819 2011 Somatostatin receptors SSTR2 and SSTR5 are expressed in the human thoracic duct.
21503779 2011 Gene expression of somatostatin receptor subtypes SSTR2a, SSTR3 and SSTR5 in peripheral blood of neuroendocrine lung cancer affected patients.
21419811 2011 Role of somatostatin receptor 1 and 5 on epidermal growth factor receptor mediated signaling.
21383526 2011 Differential gene expression profiles of POMC-related enzymes, transcription factors and receptors between non-pituitary and pituitary ACTH-secreting tumors.
21249361 2011 The hypofunctional effect of P335L single nucleotide polymorphism on SSTR5 function.
21238583 2011 Receptor specific crosstalk and modulation of signaling upon heterodimerization between ?1-adrenergic receptor and somatostatin receptor-5.
21190959 2011 Dissociation of epidermal growth factor receptor and ErbB2 heterodimers in the presence of somatostatin receptor 5 modulate signaling pathways.
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20739383 2010 Overexpression and functional relevance of somatostatin receptor-1, -2, and -5 in endometrium and endometriotic lesions.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20717067 2010 Profiling of somatostatin receptor subtype expression by quantitative PCR and correlation with clinicopathological features in pancreatic endocrine tumors.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20529830 2010 SSTR1 and SSTR5 subtypes are the dominant forms of somatostatin receptor in neuroendocrine tumors.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20233783 2010 A potential inhibitory role for the new truncated variant of somatostatin receptor 5, sst5TMD4, in pituitary adenomas poorly responsive to somatostatin analogs.
20207824 2010 Importance of asparagine residues at positions 13 and 26 on the amino-terminal domain of human somatostatin receptor subtype-5 in signalling.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20182388 2010 Somatostatin receptor subtypes in human type 2 diabetic islets.
20150960 2009 Differential between protein and mRNA expression of CCR7 and SSTR5 receptors in Crohn's disease patients.
19894022 2010 Immunohistochemical detection of somatostatin receptor subtype 5 (SSTR-5) in cushing adenoma.
19748526 2010 The role of G-proteins in the dimerisation of human somatostatin receptor types 2 and 5.
19423539 2009 Genetic variation in the SST gene and its receptors in relation to circulating levels of insulin-like growth factor-I, IGFBP3, and prostate cancer risk.
19401364 2009 Identification and characterization of two novel truncated but functional isoforms of the somatostatin receptor subtype 5 differentially present in pituitary tumors.
19342453 2009 Characterization of intracellular signaling mediated by human somatostatin receptor 5: role of the DRY motif and the third intracellular loop.
19330452 2009 Acromegaly: correlation between expression of somatostatin receptor subtypes and response to octreotide-lar treatment.
19318729 2009 Differential expression of somatostatin and dopamine receptor subtype genes in adrenocorticotropin (ACTH)-secreting pituitary tumors and silent corticotroph adenomas.
19070659 2009 Somatostatin receptors 1 and 5 heterodimerize with epidermal growth factor receptor: agonist-dependent modulation of the downstream MAPK signalling pathway in breast cancer cells.
18936524 2008 Immunohistochemical detection and localization of somatostatin receptor subtypes in prostate tissue from patients with bladder outlet obstruction.
18653781 2008 Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18066572 2008 The expression of somatostatin receptors 3, 4 and 5 in laryngeal pathology.
17159301 2007 Expression of type 5 somatostatin receptor in TSH-secreting pituitary adenomas: a possible marker for predicting long-term response to octreotide therapy.
16954443 2006 Octreotide promotes apoptosis in human somatotroph tumor cells by activating somatostatin receptor type 2.
16690617 2006 Regulation of neuronal nitric-oxide synthase activity by somatostatin analogs following SST5 somatostatin receptor activation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16216913 2005 Dopamine receptor subtype 2 and somatostatin receptor subtype 5 expression influences somatostatin analogs effects on human somatotroph pituitary adenomas in vitro.
16214911 2005 Genetic variation in the growth hormone synthesis pathway in relation to circulating insulin-like growth factor-I, insulin-like growth factor binding protein-3, and breast cancer risk: results from the European prospective investigation into cancer and nutrition study.
16012170 2005 Interactions with PDZ domain proteins PIST/GOPC and PDZK1 regulate intracellular sorting of the somatostatin receptor subtype 5.
15914528 2005 Analysis of somatostatin receptors 2 and 5 polymorphisms in patients with acromegaly.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15247250 2004 The role of subtype-specific ligand binding and the C-tail domain in dimer formation of human somatostatin receptors.
15118275 2004 Somatostatin (SRIF) receptor subtype 2 and 5 gene expression in growth hormone-secreting pituitary adenomas: the relationship with endogenous srif activity and response to octreotide.
14602773 2003 Somatostatin receptors 2 and 5 are the major somatostatin receptors in insulinomas: an in vivo and in vitro study.
12898583 2003 Analysis of transmission of novel polymorphisms in the somatostatin receptor 5 (SSTR5) gene in patients with autism.
12414882 2002 Somatostatin receptor genes are expressed in lymphocytes from retroorbital tissues in Graves' disease.
12192619 2002 Novel polymorphisms in the somatostatin receptor 5 (SSTR5) gene associated with bipolar affective disorder.
12072395 2002 Identification of an upstream pituitary-active promoter of human somatostatin receptor subtype 5.
12021920 2002 Expression of somatostatin receptor types 1-5 in 81 cases of gastrointestinal and pancreatic endocrine tumors. A correlative immunohistochemical and reverse-transcriptase polymerase chain reaction analysis.
11753241 2001 [Somatostatin receptor genes expression and effects of octreotide on orbital fibroblasts from Graves' ophthalmopathy].
11502816 2001 Mutation of somatostatin receptor type 5 in an acromegalic patient resistant to somatostatin analog treatment.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
10753124 2000 Receptors for dopamine and somatostatin: formation of hetero-oligomers with enhanced functional activity.
10713101 2000 Subtypes of the somatostatin receptor assemble as functional homo- and heterodimers.
9892225 1999 Subtype-selective expression of the five somatostatin receptors (hSSTR1-5) in human pancreatic islet cells: a quantitative double-label immunohistochemical analysis.
9892014 1999 C-terminal region of human somatostatin receptor 5 is required for induction of Rb and G1 cell cycle arrest.
9694905 1998 The cytoplasmic tail of the human somatostatin receptor type 5 is crucial for interaction with adenylyl cyclase and in mediating desensitization and internalization.
9279525 1997 Somatostatin receptor subtype gene expression in human endocrine gastroentero-pancreatic tumours.
9205124 1997 Cloning, mRNA expression, and chromosomal mapping of mouse and human preprocortistatin.
9177396 1997 Somatostatin receptor subtype expression in human thyroid and thyroid carcinoma cell lines.
9125122 1997 Identification and characterization of a novel human cortistatin-like peptide.
8449518 1993 Human somatostatin receptor genes: localization to human chromosomes 14, 17, and 22 and identification of simple tandem repeat polymorphisms.
8373420 1993 Cloning, functional expression and pharmacological characterization of a fourth (hSSTR4) and a fifth (hSSTR5) human somatostatin receptor subtype.
8078491 1994 Characterization of cloned human somatostatin receptor SSTR5.
7908405 1994 Molecular cloning, functional characterization, and chromosomal localization of a human somatostatin receptor (somatostatin receptor type 5) with preferential affinity for somatostatin-28.
7607700 1995 Localization of human somatostatin receptor 5 gene (SSTR5) to chromosome band 16p13.3 by fluorescence in situ hybridization.
6145156 1984 Primary structure of the gene encoding rat preprosomatostatin.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
1346068 1992 Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney.