Property Summary

Ligand Count 280
NCBI Gene PubMed Count 96
PubMed Score 120.84
PubTator Score 179.29

Knowledge Summary

Patent (12,063)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 6.0e-04

 OMIM Phenotype (1)

Gene RIF (77)

AA Sequence

MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAK      1 - 70
MKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLA     71 - 140
VVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGF    141 - 210
FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEP    211 - 280
ASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPA    281 - 350
HRAAANGLMQTSKL                                                            351 - 364
//

Text Mined References (97)

PMID Year Title