Property Summary

NCBI Gene PubMed Count 48
PubMed Score 43.93
PubTator Score 44.49

Knowledge Summary

Patent (7,607)

TINX Plot

 IMPC Phenotype (1)

 HCA RNA Cell Line (2)

Gene RIF (24)

PMID Text
26474434 Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
25962406 An immunohistochemical investigation of the expression of somatostatin receptor subtypes
24743707 this study shows that CD26 is associated with SSTR4 in malignant pleural mesothelioma cells, and this interaction inhibits SSTR4-mediated cytostatic effects.
24602981 deregulated somatostatin signaling in the Alzheimer disease cortices studied cannot be explained by hypermethylation of the SST or SSTR4 promoter CpG islands.
23991955 High SSTR4 expression is associated with lymph node metastasis in gallbladder cancer.
20810604 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20717067 Data show that the mRNA levels of SSTR1, SSTR2, SSTR3, and SSTR5 were high in PET compared with AC, whereas the expression of SSTR4 was low in PET and AC.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233783 Evaluation of the potential use of sst5TMD4 expression in surgically removed pituitary adenomas as a predictor of the subsequent response of different pituitary tumors to somatostatin therapy.
20182388 Studies show that this study may be the basis for further functional studies to evaluate the role of somatostatin receptors sst1 to sst5 in the diabetic state.
19687471 the expression, localization, and inflammation-induced alterations of sst(4) receptors in murine and human lungs
19426801 Heterodimerization between somatostatin receptor 4 and somatostatin receptor 5 exerted receptor and ligand specific changes in receptor coupling to adenylyl cyclase and the downstream signaling pathway.
19423539 Observational study of gene-disease association. (HuGE Navigator)
19330452 In somatotrophinomas patients treated with somatostatin analogs, the most expressed SSTR was SSTR5, SSTR3, SSTR2, SSTR1, and SSTR4, respectively.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18936524 Immunohistochemistry stufy of SSTR4 in prostate tissue from patients with bladder outlet obstruction showed that close to 90% of secretory cells showed a weak positivity in the cytoplasm.
18066572 A variable degree of SSTR4 was detected in laryngeal benign, premalignant and malignant specimens, with the greatest percentage in teh malignant specimens.
16214911 Observational study of gene-disease association. (HuGE Navigator)
12414882 somatostatin receptor transcripts were found in lymphocytes both from Graves' ophthalmopathy retroorbital tissues and blood samples, with levels of expression of SST1, -2, and -4 mRNA higher than those of the SST3 and -5 transcripts
12210479 expression of SSTR4 transcripts up-regulated in prostatic carcinoma cells; SSTR4 agonists may have role in treatment of prostate cancer
12021920 SSTRs 1-5 are heterogeneously expressed in gastroenteropancreatic endocrine tumors
11753241 SSTR transcripts are expressed and functional in retroorbital fibroblasts. SSTR1 is expressed in Grave's disease and octreotide inhibits retroorbital cell growth, explaining the SRIH therapeutic effect.

AA Sequence

MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLVGLVGNALVIF      1 - 70
VILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVL     71 - 140
SVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAV    141 - 210
FVVYTFLLGFLLPVLAIGLCYLLIVGKMRAVALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQL    211 - 280
LNLFVTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATA    281 - 350
LKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF                                    351 - 388
//

Text Mined References (48)

PMID Year Title
26474434 2016 Prognostic Value of Somatostatin Receptor Subtypes in Pancreatic Neuroendocrine Tumors.
25962406 2015 An immunohistochemical investigation of the expression of somatostatin receptor subtypes - should therapeutic trials be performed to determine the efficacy of somatostatin analogs in treating advanced thyroid malignances?
24743707 2014 Regulation of somatostatin receptor 4-mediated cytostatic effects by CD26 in malignant pleural mesothelioma.
24602981 2014 Methylation analysis of SST and SSTR4 promoters in the neocortex of Alzheimer's disease patients.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23991955 2013 Somatostatin receptors 3, 4 and 5 play important roles in gallbladder cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20717067 2010 Profiling of somatostatin receptor subtype expression by quantitative PCR and correlation with clinicopathological features in pancreatic endocrine tumors.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20233783 2010 A potential inhibitory role for the new truncated variant of somatostatin receptor 5, sst5TMD4, in pituitary adenomas poorly responsive to somatostatin analogs.
20182388 2010 Somatostatin receptor subtypes in human type 2 diabetic islets.
19687471 2009 Expression of the somatostatin receptor subtype 4 in intact and inflamed pulmonary tissues.
19426801 2009 C-tail mediated modulation of somatostatin receptor type-4 homo- and heterodimerizations and signaling.
19423539 2009 Genetic variation in the SST gene and its receptors in relation to circulating levels of insulin-like growth factor-I, IGFBP3, and prostate cancer risk.
19330452 2009 Acromegaly: correlation between expression of somatostatin receptor subtypes and response to octreotide-lar treatment.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18936524 2008 Immunohistochemical detection and localization of somatostatin receptor subtypes in prostate tissue from patients with bladder outlet obstruction.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18066572 2008 The expression of somatostatin receptors 3, 4 and 5 in laryngeal pathology.
16214911 2005 Genetic variation in the growth hormone synthesis pathway in relation to circulating insulin-like growth factor-I, insulin-like growth factor binding protein-3, and breast cancer risk: results from the European prospective investigation into cancer and nutrition study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414882 2002 Somatostatin receptor genes are expressed in lymphocytes from retroorbital tissues in Graves' disease.
12210479 2002 Expression of somatostatin receptor subtypes 2 and 4 in human benign prostatic hyperplasia and prostatic cancer.
12021920 2002 Expression of somatostatin receptor types 1-5 in 81 cases of gastrointestinal and pancreatic endocrine tumors. A correlative immunohistochemical and reverse-transcriptase polymerase chain reaction analysis.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11753241 2001 [Somatostatin receptor genes expression and effects of octreotide on orbital fibroblasts from Graves' ophthalmopathy].
11472428 2001 Somatostatin receptor (SSTR) expression and function in normal and leukaemic T-cells. Evidence for selective effects on adhesion to extracellular matrix components via SSTR2 and/or 3.
11344221 2001 Somatostatin receptor subtypes 2 and 5 differentially affect proliferation in vitro of the human medullary thyroid carcinoma cell line tt.
10768564 2000 111In-DTPA-D-Phe1-octreotide binding and somatostatin receptor subtypes in thyroid tumors.
10433861 1999 Somatostatin and its receptor family.
9892014 1999 C-terminal region of human somatostatin receptor 5 is required for induction of Rb and G1 cell cycle arrest.
9279525 1997 Somatostatin receptor subtype gene expression in human endocrine gastroentero-pancreatic tumours.
9205124 1997 Cloning, mRNA expression, and chromosomal mapping of mouse and human preprocortistatin.
9125122 1997 Identification and characterization of a novel human cortistatin-like peptide.
8512564 1993 Molecular cloning and sequencing of a human somatostatin receptor, hSSTR4.
8483934 1993 Cloning and characterization of a fourth human somatostatin receptor.
8449518 1993 Human somatostatin receptor genes: localization to human chromosomes 14, 17, and 22 and identification of simple tandem repeat polymorphisms.
8405411 1993 Distribution and second messenger coupling of four somatostatin receptor subtypes expressed in brain.
8373420 1993 Cloning, functional expression and pharmacological characterization of a fourth (hSSTR4) and a fifth (hSSTR5) human somatostatin receptor subtype.
8244401 1993 Human somatostatin receptor genes: localization of SSTR5 to human chromosome 20p11.2.
8100352 1993 Cloning and expression of a human somatostatin-14-selective receptor variant (somatostatin receptor 4) located on chromosome 20.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
1346068 1992 Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney.