Property Summary

Ligand Count 68
NCBI Gene PubMed Count 59
PubMed Score 126.20
PubTator Score 105.55

Knowledge Summary

Patent (8,420)

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -3.500 1.5e-03
astrocytoma -2.400 5.6e-18
atypical teratoid / rhabdoid tumor -4.100 6.4e-07
cystic fibrosis 3.586 2.0e-07
glioblastoma -2.700 1.8e-04
group 3 medulloblastoma -4.100 4.6e-03
interstitial cystitis -2.200 4.3e-03
intraductal papillary-mucinous adenoma (... 3.600 8.3e-05
intraductal papillary-mucinous carcinoma... 3.100 4.2e-03
intraductal papillary-mucinous neoplasm ... 2.300 1.9e-02
lung adenocarcinoma -1.300 4.1e-08
lung cancer 1.200 7.7e-03
lung carcinoma 1.100 1.0e-08
medulloblastoma, large-cell -4.700 1.3e-04
non-small cell lung cancer -2.050 4.6e-18
oligodendroglioma -2.200 8.5e-12
osteosarcoma -1.260 6.1e-06
ovarian cancer -2.300 6.9e-15
Pick disease -1.200 1.6e-03
primitive neuroectodermal tumor -3.100 5.4e-03
psoriasis -1.100 3.3e-31
ulcerative colitis -1.500 1.5e-03

Gene RIF (40)

AA Sequence

MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL      1 - 70
VGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVN     71 - 140
MFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNM    141 - 210
LMPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVF    211 - 280
VICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEP    281 - 350
VDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL                                 351 - 391
//

Text Mined References (59)

PMID Year Title