Property Summary

NCBI Gene PubMed Count 59
PubMed Score 126.29
PubTator Score 105.55

Knowledge Summary

Patent (8,420)

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytoma -2.400 5.6e-18
glioblastoma -4.300 5.0e-06
oligodendroglioma -2.200 8.5e-12
osteosarcoma -1.260 6.1e-06
medulloblastoma -4.500 1.1e-08
cystic fibrosis 3.586 2.0e-07
atypical teratoid / rhabdoid tumor -4.100 6.4e-07
medulloblastoma, large-cell -4.700 1.3e-04
primitive neuroectodermal tumor -3.100 5.4e-03
non-small cell lung cancer -2.050 4.6e-18
intraductal papillary-mucinous adenoma (... 3.600 8.3e-05
intraductal papillary-mucinous carcinoma... 3.100 4.2e-03
intraductal papillary-mucinous neoplasm ... 2.300 1.9e-02
lung cancer 1.200 7.7e-03
interstitial cystitis -2.400 5.0e-04
adult high grade glioma -3.500 1.5e-03
lung adenocarcinoma -1.300 4.1e-08
lung carcinoma 1.100 1.0e-08
Pick disease -1.200 1.6e-03
ulcerative colitis -1.500 1.5e-03
ovarian cancer -2.300 6.9e-15
psoriasis -1.100 3.3e-31

Gene RIF (40)

PMID Text
26474434 Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
25962406 An immunohistochemical investigation of the expression of somatostatin receptor subtypes
25734919 Aberrant methylation inactivates somatostatin and SSTR1 in head and neck squamous cell carcinoma.
24742330 SSTR-PET showed high sensitivity for imaging bone, soft tissue and brain metastases, and particularly in combination with CT had a significant impact on clinical stage and patient management.
24634938 Tumor cells in the tissue samples of the patients diagnosed with advanced-stage hepatocellular carcinoma expressed a high proportion of SSTR1 and SSTR5.
24512486 SSTRs are overexpressed in primary pigmented nodular adrenocortical disease tissues in comparison with normal adrenal cortex
24106690 Somatostatin receptor imaging (SRI) using SPECT or PET as a whole-body imaging technique has become a crucial part of the management of Neuroendocrine tumors
23722468 Somatostatin receptor 1 is a novel methylated gene driven by EBV infection in gastric cancer cells and acts as a potential tumour suppressor.
23466804 The UMB-7 may prove of great value in the identification of sst1-expressing tumors during routine histopathological examinations. This may open up new routes for diagnostic and therapeutic intervention.
23455179 Activated/phosphorylated pMAPK 44/42 was detected in 82% of medulloblastomas, all subtypes, and in 62.5% of primitive neuroectodermal tumors with coexpression of SSR1 in one third.
21419811 Data demonstrate that cells transfected with SSTR1 or SSTR1/5 negatively regulates EGF mediated effects attributed to the inhibition of EGFR phosphorylation.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20810604 Observational study of gene-disease association. (HuGE Navigator)
20739383 Overexpressed in endomterium inendometriosis.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20717067 Data show that the mRNA levels of SSTR1, SSTR2, SSTR3, and SSTR5 were high in PET compared with AC, whereas the expression of SSTR4 was low in PET and AC.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20529830 The summarized expression pattern of SSTR in the investigated neuroendocrine tumors in our material was: SSTR 1> SSTR 5> SSTR 3> SSTR 2A> SSTR 2B.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20182388 Studies show that this study may be the basis for further functional studies to evaluate the role of somatostatin receptors sst1 to sst5 in the diabetic state.
19423539 Observational study of gene-disease association. (HuGE Navigator)
19330452 SSTR1 had higher expression in patients that had normalized GH and IGF-I. There was a positive correlation between the percentage of tumor reduction by octreotide-lar and SSTR1 expression.
19318729 Both SSTR1 and 2 mRNA levels in SCA were greater than Cushing disease, while SSTR1 mRNA levels, but not SSTR2, in silent corticotroph adenoma were also greater than non-functioning pituitary tumor.
19106227 An autocrine and paracrine role of SST in the lacrimal system and at the ocular surface and a role of SST in corneal immunology.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19070659 To the best of our knowledge, this is the first report describing crosstalk/interactions between SSTRs and ErbBs.
18936524 Immunohistochemistry stufy of SSTR1 in prostate tissue from patients with bladder outlet obstruction showed that greatest proportion of basal cells showed a moderate intensity, strong immunoreactivity being observed only in 18.1% of cells.
18823376 the expression of SSTR-1 mRNA in human pancreatic cancer tissue specimens, and investigated the effect of SSTR-1 overexpression on cell proliferation, cell cycle, and tumor growth in a subcutaneous nude mouse model.
18347174 The most prominent candidates associated with aggressive prostate cancer were SSTR1 and genes related to proliferation, including TOP2A.
17848636 Analysis of orbital tissues reveals upregulation of SSTR1 and -2 in a group of Graves' ophthalmopathy (GO)patients. Adipogenesis, a process occurring in GO orbits, provides one possible explanation for some of the observed increase.
17533578 transcriptional regulation of the human SST1 was analyzed in the present study
16214911 Observational study of gene-disease association. (HuGE Navigator)
15247250 activation of hSSTR1 is not necessary for heterodimeric assembly
12788890 SSTR1 selective activation inhibits hormone secretion and cell viability in GH- and PRL-secreting adenomas in. SRIF analogs with affinity for SSTR1 may be useful to control hormone hypersecretion and reduce neoplastic growth of pituitary adenomas.
12474541 localization and expression in human prostatic tissue and prostate cancer cell lines
12414882 somatostatin receptor transcripts were found in lymphocytes both from Graves' ophthalmopathy retroorbital tissues and blood samples, with levels of expression of SST1, -2, and -4 mRNA higher than those of the SST3 and -5 transcripts
12376335 the expression of somatostatin (SS) and SS receptor (SSR) subtype 1 (sst1), sst2A, and sst3 in normal human thymic tissue
12359227 selective activation reduces cell growth and calcitonin secretion in a human medullary thyroid carcinoma cell line
12021920 SSTRs 1-5 are heterogeneously expressed in gastroenteropancreatic endocrine tumors
11753241 SSTR transcripts are expressed and functional in retroorbital fibroblasts. SSTR1 is expressed in Grave's disease and octreotide inhibits retroorbital cell growth, explaining the SRIH therapeutic effect.

AA Sequence

MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCL      1 - 70
VGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVN     71 - 140
MFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNM    141 - 210
LMPEPAQRWLVGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVF    211 - 280
VICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEP    281 - 350
VDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL                                 351 - 391
//

Text Mined References (59)

PMID Year Title
26474434 2016 Prognostic Value of Somatostatin Receptor Subtypes in Pancreatic Neuroendocrine Tumors.
25962406 2015 An immunohistochemical investigation of the expression of somatostatin receptor subtypes - should therapeutic trials be performed to determine the efficacy of somatostatin analogs in treating advanced thyroid malignances?
25734919 2015 Aberrant methylation inactivates somatostatin and somatostatin receptor type 1 in head and neck squamous cell carcinoma.
24742330 2014 Somatostatin receptor expression in Merkel cell carcinoma as target for molecular imaging.
24634938 2013 Somatostatin receptor 1 (SSTR1) and somatostatin receptor 5 (SSTR5)expression in hepatocellular carcinoma.
24512486 2014 Does somatostatin have a role in the regulation of cortisol secretion in primary pigmented nodular adrenocortical disease (ppnad)? a clinical and in vitro investigation.
24106690 2013 Somatostatin receptor-based molecular imaging and therapy for neuroendocrine tumors.
23722468 2013 Somatostatin receptor 1, a novel EBV-associated CpG hypermethylated gene, contributes to the pathogenesis of EBV-associated gastric cancer.
23466804 2013 Reevaluation of sst? somatostatin receptor expression in human normal and neoplastic tissues using the novel rabbit monoclonal antibody UMB-7.
23455179 2013 Differential expression of somatostatin receptors, P44/42 MAPK, and mTOR activation in medulloblastomas and primitive neuroectodermal tumors.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
21419811 2011 Role of somatostatin receptor 1 and 5 on epidermal growth factor receptor mediated signaling.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20739383 2010 Overexpression and functional relevance of somatostatin receptor-1, -2, and -5 in endometrium and endometriotic lesions.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20717067 2010 Profiling of somatostatin receptor subtype expression by quantitative PCR and correlation with clinicopathological features in pancreatic endocrine tumors.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20529830 2010 SSTR1 and SSTR5 subtypes are the dominant forms of somatostatin receptor in neuroendocrine tumors.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20182388 2010 Somatostatin receptor subtypes in human type 2 diabetic islets.
19423539 2009 Genetic variation in the SST gene and its receptors in relation to circulating levels of insulin-like growth factor-I, IGFBP3, and prostate cancer risk.
19330452 2009 Acromegaly: correlation between expression of somatostatin receptor subtypes and response to octreotide-lar treatment.
19318729 2009 Differential expression of somatostatin and dopamine receptor subtype genes in adrenocorticotropin (ACTH)-secreting pituitary tumors and silent corticotroph adenomas.
19106227 2009 Somatostatin actions via somatostatin receptors on the ocular surface are modulated by inflammatory processes.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19070659 2009 Somatostatin receptors 1 and 5 heterodimerize with epidermal growth factor receptor: agonist-dependent modulation of the downstream MAPK signalling pathway in breast cancer cells.
18936524 2008 Immunohistochemical detection and localization of somatostatin receptor subtypes in prostate tissue from patients with bladder outlet obstruction.
18823376 2008 Somatostatin receptor-1 induces cell cycle arrest and inhibits tumor growth in pancreatic cancer.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18347174 2008 Identification of prognostic biomarkers for prostate cancer.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17848636 2007 Modulation of expression of somatostatin receptor subtypes in Graves' ophthalmopathy orbits: relevance to novel analogs.
17533578 2007 Characterization and transcriptional regulation of the human somatostatin receptor subtype 1 gene.
16214911 2005 Genetic variation in the growth hormone synthesis pathway in relation to circulating insulin-like growth factor-I, insulin-like growth factor binding protein-3, and breast cancer risk: results from the European prospective investigation into cancer and nutrition study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247250 2004 The role of subtype-specific ligand binding and the C-tail domain in dimer formation of human somatostatin receptors.
12788890 2003 Somatostatin receptor subtype 1 selective activation in human growth hormone (GH)- and prolactin (PRL)-secreting pituitary adenomas: effects on cell viability, GH, and PRL secretion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12474541 Localization and mRNA expression of somatostatin receptor subtypes in human prostatic tissue and prostate cancer cell lines.
12414882 2002 Somatostatin receptor genes are expressed in lymphocytes from retroorbital tissues in Graves' disease.
12376335 2002 Quantitative and functional expression of somatostatin receptor subtypes in human thymocytes.
12359227 2002 Somatostatin receptor subtype 1-selective activation reduces cell growth and calcitonin secretion in a human medullary thyroid carcinoma cell line.
12021920 2002 Expression of somatostatin receptor types 1-5 in 81 cases of gastrointestinal and pancreatic endocrine tumors. A correlative immunohistochemical and reverse-transcriptase polymerase chain reaction analysis.
11753241 2001 [Somatostatin receptor genes expression and effects of octreotide on orbital fibroblasts from Graves' ophthalmopathy].
11527930 2001 Somatostatin receptor gene expression in human ocular tissues: RT-PCR and immunohistochemical study.
11344221 2001 Somatostatin receptor subtypes 2 and 5 differentially affect proliferation in vitro of the human medullary thyroid carcinoma cell line tt.
10734105 2000 Interaction of the somatostatin receptor subtype 1 with the human homolog of the Shk1 kinase-binding protein from yeast.
10713101 2000 Subtypes of the somatostatin receptor assemble as functional homo- and heterodimers.
9892225 1999 Subtype-selective expression of the five somatostatin receptors (hSSTR1-5) in human pancreatic islet cells: a quantitative double-label immunohistochemical analysis.
9886848 1999 In vitro characterization of somatostatin receptors in the human thymus and effects of somatostatin and octreotide on cultured thymic epithelial cells.
9279525 1997 Somatostatin receptor subtype gene expression in human endocrine gastroentero-pancreatic tumours.
9205124 1997 Cloning, mRNA expression, and chromosomal mapping of mouse and human preprocortistatin.
9125122 1997 Identification and characterization of a novel human cortistatin-like peptide.
8622562 1996 Messenger RNA expression of somatostatin receptor subtypes in human and rat gastric mucosae.
8449518 1993 Human somatostatin receptor genes: localization to human chromosomes 14, 17, and 22 and identification of simple tandem repeat polymorphisms.
8405411 1993 Distribution and second messenger coupling of four somatostatin receptor subtypes expressed in brain.
7968260 1994 Gene expression of somatostatin receptor subtypes, SSTR1 and SSTR2, in human lung cancer cell lines.
1346068 1992 Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney.