Property Summary

NCBI Gene PubMed Count 92
PubMed Score 13572.01
PubTator Score 1988.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Acromegaly 51 7.616 3.8
Adenoma 167 6.228 3.1
Pituitary adenoma 38 5.859 2.9
Cancer 2499 5.719 2.9
Diarrhea 253 5.712 2.9
Hypoglycemia 152 5.488 2.7
diabetes mellitus 1728 5.438 2.7
Esophageal varix 12 5.37 2.7
Hyperglycemia 137 5.288 2.6
Cushing's syndrome 48 5.191 2.6
Zollinger-Ellison syndrome 18 4.979 2.5
Hyperinsulinemic hypoglycemia 17 4.947 2.5
Portal hypertension 20 4.946 2.5
Duodenal ulcer 20 4.921 2.5
Hyperinsulinism 133 4.883 2.4
Varicose veins 20 4.754 2.4
Dumping syndrome 8 4.734 2.4
Pancreatic cholera 6 4.658 2.3
Cholelithiasis 33 4.551 2.3
Congenital chylothorax 3 4.365 2.2
Gastritis 47 4.348 2.2
Hyperthyroidism 53 4.31 2.2
Multiple Endocrine Neoplasia Type 1 29 4.245 2.1
Epilepsy 792 4.195 2.1
Liver Cirrhosis 181 4.164 2.1
Polycystic liver disease 16 4.115 2.1
Dementia 175 4.023 2.0
Angiodysplasia 5 3.958 2.0
Steatorrhea 34 3.944 2.0
Hypopituitarism 40 3.943 2.0
Intestinal Obstruction 31 3.75 1.9
Huntington's disease 76 3.67 1.8
Nelson syndrome 6 3.669 1.8
Obesity 678 3.663 1.8
Hyperprolactinemia 27 3.543 1.8
Constipation 181 3.519 1.8
Kidney disease 430 3.512 1.8
Short bowel syndrome 16 3.484 1.7
Irritable bowel syndrome 60 3.426 1.7
Hypothyroidism 122 3.42 1.7
Dyspepsia 33 3.384 1.7
Pain agnosia 104 3.311 1.7
Diabetic retinopathy 56 3.234 1.6
Hypertension 396 3.173 1.6
Phaeochromocytoma 20 3.142 1.6
Autosomal dominant polycystic kidney disease 31 3.093 1.5
McCune Albright syndrome 19 3.07 1.5
Thyrotoxicosis 38 3.004 1.5

Expression

  Differential Expression (23)

Disease log2 FC p
Alzheimer's disease -2.700 1.6e-02
adrenocortical adenoma -1.066 1.1e-02
adrenocortical carcinoma -1.084 1.9e-04
adult high grade glioma -3.800 4.2e-03
astrocytic glioma -3.300 1.7e-03
Astrocytoma, Pilocytic -5.100 1.4e-07
atypical teratoid / rhabdoid tumor -4.200 2.9e-06
colon cancer -2.500 7.8e-03
Down syndrome -1.800 2.4e-02
ependymoma -4.500 6.5e-04
fibroadenoma 2.000 9.7e-04
glioblastoma -4.200 2.7e-08
group 4 medulloblastoma -3.600 1.1e-02
intraductal papillary-mucinous adenoma (... -2.800 2.1e-02
intraductal papillary-mucinous carcinoma... -4.500 4.1e-04
intraductal papillary-mucinous neoplasm ... -4.100 3.8e-03
lung cancer 1.300 6.7e-03
oligodendroglioma -3.400 1.2e-03
ovarian cancer 2.200 6.5e-03
pancreatic cancer -1.600 1.4e-02
Parkinson's disease -1.300 3.1e-02
Pick disease -2.400 6.7e-04
primary pancreatic ductal adenocarcinoma -1.593 1.6e-02

 GO Function (1)

Gene RIF (82)

AA Sequence

MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEP      1 - 70
EDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC                             71 - 116
//

Text Mined References (94)

PMID Year Title