Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.33
PubTator Score 269.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 4.2e-11
ovarian cancer 8491 2.1e-05
Multiple myeloma 1327 1.2e-03
Disease Target Count Z-score Confidence
Fasciitis 3 3.705 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.205 1.2e-03
lung adenocarcinoma 1.200 4.2e-11
ovarian cancer 1.300 2.1e-05

Pathway (1)

Gene RIF (3)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with Sjogren syndrome/scleroderma autoantigen 1 (SSSCA1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21292307 Our method identified a strong relationship between p27 expression and prostate cancer recurrence.
19574837 The current results showed that p27 expression were associated with glioma grade.

AA Sequence

MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYC      1 - 70
VACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPA     71 - 140
PAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH               141 - 199
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22190034 2011 Global landscape of HIV-human protein complexes.
21292307 2011 Subcellular localization of p27 and prostate cancer recurrence: automated digital microscopy analysis of tissue microarrays.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19574837 2009 Expression of CRM1 in human gliomas and its significance in p27 expression and clinical prognosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
9486406 1998 cDNA cloning of a novel autoantigen targeted by a minor subset of anti-centromere antibodies.