Property Summary

NCBI Gene PubMed Count 15
PubMed Score 37.45
PubTator Score 25.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.500 1.4e-06
glioblastoma 1.100 3.9e-03
intraductal papillary-mucinous neoplasm ... -1.100 6.5e-03
lung cancer 1.100 6.2e-04
diabetes mellitus -1.200 8.7e-03
ovarian cancer -1.500 1.3e-05

 MGI Phenotype (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFG      1 - 70
IVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFD     71 - 140
RRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN                               141 - 183
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18724357 2008 STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling.
18293417 2008 Epigenetic modifications of SOX2 enhancers, SRR1 and SRR2, correlate with in vitro neural differentiation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10471800 1999 Oligomeric complexes involved in translocation of proteins across the membrane of the endoplasmic reticulum.
9631292 1998 The role of assembly in insulin's biosynthesis.
8286409 1994 Cloning and sequence analysis of the beta subunit of the human translocon-associated protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7916687 1993 A tetrameric complex of membrane proteins in the endoplasmic reticulum.
7789174 1995 Isolation and mapping of the human beta-signal sequence receptor gene (SSR2).
3021779 1986 The signal recognition particle receptor is a complex that contains two distinct polypeptide chains.