1. Home
  2. Targets
  3. Translocon-associated protein subunit beta

Tbio Translocon-associated protein subunit beta

TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 15
PubMed Score 37.45
PubTator Score 25.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count Z-score Confidence
Calcaneonavicular coalition 1 6.343 3.2

Expression

  Differential Expression (6)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.500 1.4e-06
glioblastoma 1.100 3.9e-03
intraductal papillary-mucinous neoplasm ... -1.100 6.5e-03
lung cancer 1.100 6.2e-04
diabetes mellitus -1.200 8.7e-03
ovarian cancer -1.500 1.3e-05

Synonym

Accession P43308 B2R9K9 D3DVA7 Q53HI0 Q5VY95 Q5VY96 Q6IB31 Q9BWE4 TRAP-beta
Symbols TLAP
HSD25
TRAPB
TRAP-BETA

Gene

SSR2

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (8)

 GO Component (3)

 GO Process (1)

 Compartment GO Term (22)

See all...

 IMPC Phenotype (1)

 MGI Phenotype (1)

 HCA RNA Cell Line (56)

See all...

 CSPA Cell Line (29)

See all...

Pathway (6)

Protein-protein Interaction (88)

RPLP1   RPLP2   RPLP0   RPS17   RPSA   RPS2   RPL35A   RPL7   RPL17   RPS4Y1   RPS3   RPS12   RPL13   RPL10   RPL12   RPL9   RPL22   RPL4   RPS19   RPL3   RPL13A   RPS27   RPL35   SSR1   RPL27A   RPL5   RPL21   RPL28   RPS9   RPS5   RPS10   RPL29   RPL34   RPL14   SSR4   SEC61G   RPS20   SPCS3   RPS3A   RPL26   RPL15   RPL27   RPL37A   RPL37   RPS7   RPS8   RPS15A   RPS16   RPS14   RPS23   RPS18   RPS29   RPS13   RPS11   RPL7A   RPS4X   RPL23A   RPS6   RPL23   RPS15   RPS24   RPS25   RPS26   RPS28   FAU   RPL30   RPL39   RPL31   RPL10A   RPL32   RPL11   RPL8   RPL41   RPS27A   UBA52   RPL38   RPS21   RPL24   RPL36A   RPL19   RPL18A   RPL6   RPL18   TRAM1   ERO1A   SRP68   SSR3   RPL36  

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence 

MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFG      1 - 70
IVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFD     71 - 140
RRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN                               141 - 183
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18724357 2008 STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling.
18293417 2008 Epigenetic modifications of SOX2 enhancers, SRR1 and SRR2, correlate with in vitro neural differentiation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10471800 1999 Oligomeric complexes involved in translocation of proteins across the membrane of the endoplasmic reticulum.
9631292 1998 The role of assembly in insulin's biosynthesis.
8286409 1994 Cloning and sequence analysis of the beta subunit of the human translocon-associated protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7916687 1993 A tetrameric complex of membrane proteins in the endoplasmic reticulum.
7789174 1995 Isolation and mapping of the human beta-signal sequence receptor gene (SSR2).
3021779 1986 The signal recognition particle receptor is a complex that contains two distinct polypeptide chains.