Property Summary

NCBI Gene PubMed Count 18
PubMed Score 66.75
PubTator Score 120.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.600 1.3e-03

Gene RIF (2)

AA Sequence

MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNE      1 - 70
FDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS                          71 - 119
//

Text Mined References (22)

PMID Year Title