Property Summary

NCBI Gene PubMed Count 18
PubMed Score 57.59
PubTator Score 120.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 1.3e-03
Disease Target Count Z-score Confidence
Paralytic squint 4 4.175 2.1
Adenoiditis 5 3.841 1.9
Supraglottis cancer 2 3.114 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.600 1.3e-03

Synonym

Accession O43805 Q5VSG0 Q6FG70 Q9BVW8
Symbols N14
NA14
NA-14

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
25390646 NA14 may act as an adaptor protein regulating SPG4 localization to centrosomes, temporally and spatially regulating the microtubule-severing activity of SPG4 that is particularly critical during the cell cycle and neuronal development.
22008182 purification and characterization of NA14 and some variants; NA14 structure may be stabilized by two Glu-COO(-) ||| HO-Tyr H-bonds, highly conserved in NA14-like proteins in other species

AA Sequence

MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNE      1 - 70
FDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS                          71 - 119
//

Text Mined References (22)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
25390646 2014 Spastin-interacting protein NA14/SSNA1 functions in cytokinesis and axon development.
22008182 2011 Characterization of the structure and self-recognition of the human centrosomal protein NA14: implications for stability and function.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15269182 2004 Spastin interacts with the centrosomal protein NA14, and is enriched in the spindle pole, the midbody and the distal axon.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
9430706 1998 NA14 is a novel nuclear autoantigen with a coiled-coil domain.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.