Property Summary

NCBI Gene PubMed Count 13
PubMed Score 32.69
PubTator Score 12.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.500 1.2e-03
psoriasis -3.700 2.8e-06
glioblastoma -1.700 4.4e-04
oligodendroglioma -1.300 1.7e-15
osteosarcoma -2.339 2.6e-04
medulloblastoma, large-cell 1.400 4.5e-05
primary pancreatic ductal adenocarcinoma 1.234 1.5e-02
tuberculosis 1.700 7.5e-07
adult high grade glioma -1.200 4.1e-03
pilocytic astrocytoma -1.300 2.1e-05
subependymal giant cell astrocytoma -2.902 2.5e-02
ovarian cancer -2.000 9.6e-07
Gaucher disease type 1 1.700 5.7e-03
pancreatic cancer 1.100 6.6e-03

Gene RIF (5)

PMID Text
26495868 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic beta-Cell Target Genes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18080319 phosphorylation involving N-terminal tyrosine residues of Ssdp1 is a means of regulating its nuclear localization and subsequent transcriptional activation of LIM-HD complexes.
16325762 Thus, biochemical data of SSDP1 presented by this study provides biochemical evidence for a better understanding of transcriptional regulation.
12381786 Ssdp proteins interact with the LIM-domain-binding protein Ldb1 to regulate development

AA Sequence

MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLY      1 - 70
CAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNP     71 - 140
SSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMG    141 - 210
PMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPI    211 - 280
MPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNN    281 - 350
ISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV                                    351 - 388
//

Text Mined References (24)

PMID Year Title
26495868 2015 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic ?-Cell Target Genes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18080319 2008 Tyrosine phosphorylation controls nuclear localization and transcriptional activity of Ssdp1 in mammalian cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16325762 2006 Structure and functional characterization of single-strand DNA binding protein SSDP1: carboxyl-terminal of SSDP1 has transcription activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12381786 2002 Ssdp proteins interact with the LIM-domain-binding protein Ldb1 to regulate development.
12079286 2002 A novel, evolutionarily conserved gene family with putative sequence-specific single-stranded DNA-binding activity.
10524251 1999 Cloning of a cDNA encoding a sequence-specific single-stranded-DNA-binding protein from Rattus norvegicus.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.