Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.01
PubTator Score 13.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.200 1.4e-03
Astrocytoma, Pilocytic -1.700 4.1e-05
atypical teratoid / rhabdoid tumor -1.100 4.6e-03
Breast cancer -2.200 1.2e-22
colon cancer -2.300 2.9e-05
Common variable immunodeficiency -1.102 1.4e-02
cystic fibrosis -1.200 1.3e-04
ependymoma -1.300 4.2e-02
glioblastoma -1.600 5.5e-05
group 4 medulloblastoma -1.100 1.1e-02
lung cancer -2.800 3.4e-05
lung carcinoma 1.300 3.3e-16
medulloblastoma, large-cell -1.400 7.5e-04
oligodendroglioma -1.600 3.0e-02
osteosarcoma -1.478 7.9e-03
ovarian cancer -1.500 8.6e-06
Pick disease -1.100 6.2e-04
pituitary cancer 1.500 9.9e-10
psoriasis -1.100 6.9e-07

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (9)

AA Sequence

MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWD      1 - 70
LYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLR     71 - 140
IPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPG    141 - 210
MNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPN    211 - 280
RPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQS    281 - 350
ESYSPSMTMSV                                                               351 - 361
//

Text Mined References (28)

PMID Year Title