Property Summary

NCBI Gene PubMed Count 43
PubMed Score 49.24
PubTator Score 53.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma -1.200 1.2e-02
Waldenstrons macroglobulinemia 1.310 1.6e-02
Multiple myeloma 2.656 1.1e-04
osteosarcoma 3.379 5.7e-08
glioblastoma 1.200 3.4e-08
tuberculosis and treatment for 6 months 1.400 7.7e-05
intraductal papillary-mucinous adenoma (... 1.200 3.2e-03
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
lung cancer 1.600 3.7e-04
breast carcinoma 1.200 1.0e-02
adult high grade glioma 1.300 3.6e-03
group 3 medulloblastoma 1.200 1.8e-03
ovarian cancer 3.400 1.8e-05
dermatomyositis 1.400 1.8e-03

Gene RIF (21)

PMID Text
26446790 The stimulatory effect of mtSSB on Pol gamma on these ssDNA templates is not species-specific.
26170237 This study determined that hSSB1 acetylation at K94 mediated by the acetyltransferase p300 and the deacetylases SIRT4 and HDAC10 impaired its ubiquitin-mediated degradation by proteasomes.
25762445 SSBP1 protects cells from proteotoxic stresses by potentiating stress-induced HSF1 transcriptional activity
25249620 Fbxl5 interacts with and targets hSSB1 for ubiquitination and degradation, which could be prevented by ATM-mediated hSSB1 T117 phosphorylation.
23986477 In response to the DNA damage response, INTS3-hSSB1-INTS6 complex relocates to the DNA damage sites.
23290262 mtSSB potentially prevents formation of DNA breaks in ssDNA, ensuring that base removal primarily occurs in dsDNA.
23184057 Results indicate that hSSB1 may regulate DNA damage checkpoints by positively modulating p53 and its downstream target p21.
22190034 HIV-1 Rev is identified to have a physical interaction with single-stranded DNA binding protein 1 (SSBP1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22153281 Local enrichment of UNG1 at DNA-bound mtSSB may furthermore facilitate rapid access to- and processing of the damage once the dsDNA conformation is restored.
21953457 mtSSB uses distinct structural elements to interact functionally with its mtDNA replisome partners and to promote proper mtDNA replication in animal cells
21242961 hSSB1 may positively modulate p21 to regulate cell cycle progression and DNA damage response, implicating hSSB1 as a novel, promising therapeutic target for cancers such as hepatocellular carcinoma
20877624 Observational study of gene-disease association. (HuGE Navigator)
20434493 Results describe the role of mitochondrial single-stranded DNA binding protein in the maintenance of mitochondrial DNA in cultured human cells.
19786724 Data show that mtSSB bound both CKS1 and CKS2 and underwent CDK-dependent phosphorylation.
19759019 following DNA damage, SSB1 and Integrator3 relocate to the DNA damage sites and regulate the accumulation of TopBP1 and BRCA1 there
19605351 hSSB1 and hSSB2 form two separate complexes with similar structures, and both complexes participate in DNA damage response.
19066201 Identification of human mitochondrial SSB (HmtSSB) as a novel protein-binding partner of tumour suppressor p53, in mitochondria.
18305033 Zta interaction with mtSSB serves the dual function of facilitating viral and blocking mitochondrial DNA replication.
16428295 PDIP38 is located in the mitochondrial matrix. TFAM and mitochondrial single-stranded DNA binding protein (mtSSB) are co-immunoprecipitated with PDIP38
15710247 HIV-1 Rev is identified to have a physical interaction with single-stranded DNA binding protein 1 (SSBP1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12479417 SSDP1 gene encodes a protein with a conserved N-terminal FORWARD domain;The SSDP1 mRNA transcripts are distributed ubiquitously in adult human and mouse tissues.

AA Sequence

MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS      1 - 70
EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL     71 - 140
SDQTKEKE                                                                  141 - 148
//

Text Mined References (50)

PMID Year Title
26446790 2015 Mitochondrial Single-stranded DNA-binding Proteins Stimulate the Activity of DNA Polymerase ? by Organization of the Template DNA.
26170237 2015 Acetylation-dependent function of human single-stranded DNA binding protein 1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25762445 2015 Mitochondrial SSBP1 protects cells from proteotoxic stresses by potentiating stress-induced HSF1 transcriptional activity.
25249620 2014 FBXL5-mediated degradation of single-stranded DNA-binding protein hSSB1 controls DNA damage response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23986477 2013 A core hSSB1-INTS complex participates in the DNA damage response.
23568457 2013 Genetic variants associated with disordered eating.
23290262 2013 Alkyladenine DNA glycosylase (AAG) localizes to mitochondria and interacts with mitochondrial single-stranded binding protein (mtSSB).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184057 2013 hSSB1 regulates both the stability and the transcriptional activity of p53.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
22153281 2012 mtSSB may sequester UNG1 at mitochondrial ssDNA and delay uracil processing until the dsDNA conformation is restored.
21953457 2011 Reduced stimulation of recombinant DNA polymerase ? and mitochondrial DNA (mtDNA) helicase by variants of mitochondrial single-stranded DNA-binding protein (mtSSB) correlates with defects in mtDNA replication in animal cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
21242961 2011 hSSB1 binds and protects p21 from ubiquitin-mediated degradation and positively correlates with p21 in human hepatocellular carcinomas.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20434493 2010 Mitochondrial single-stranded DNA binding protein is required for maintenance of mitochondrial DNA and 7S DNA but is not required for mitochondrial nucleoid organisation.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19786724 2010 CKS proteins protect mitochondrial genome integrity by interacting with mitochondrial single-stranded DNA-binding protein.
19759019 2009 Integrator3, a partner of single-stranded DNA-binding protein 1, participates in the DNA damage response.
19683501 2009 SOSS complexes participate in the maintenance of genomic stability.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19066201 2009 Physical and functional interactions between human mitochondrial single-stranded DNA-binding protein and tumour suppressor p53.
18305033 2008 Epstein-Barr virus immediate-early protein Zta co-opts mitochondrial single-stranded DNA binding protein to promote viral and inhibit mitochondrial DNA replication.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16428295 2005 PDIP38 associates with proteins constituting the mitochondrial DNA nucleoid.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12975372 2003 TWINKLE Has 5' -> 3' DNA helicase activity and is specifically stimulated by mitochondrial single-stranded DNA-binding protein.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12479417 2002 SSDP1 gene encodes a protein with a conserved N-terminal FORWARD domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464025 2002 Linkage mapping of the ovine single-stranded DNA-binding protein 1 (SSBP1) using microsatellite marker OARCDT7.
12381786 2002 Ssdp proteins interact with the LIM-domain-binding protein Ldb1 to regulate development.
11964388 2002 Regulation of mitochondrial D-loops by transcription factor A and single-stranded DNA-binding protein.
11556757 2001 Immunocytochemical localization of mitochondrial single-stranded DNA-binding protein in mitochondria-rich cells of normal and neoplastic human tissue.
10827171 2000 In vivo functional analysis of the human mitochondrial DNA polymerase POLG expressed in cultured human cells.
9452467 1998 Differential expression of mitochondrial DNA replication factors in mammalian tissues.
9033597 1997 Crystal structure of human mitochondrial single-stranded DNA binding protein at 2.4 A resolution.
8482537 1993 Cloning of human and rat cDNAs encoding the mitochondrial single-stranded DNA-binding protein (SSB).
7789991 1995 Chromosomal localization of mitochondrial transcription factor A (TCF6), single-stranded DNA-binding protein (SSBP), and endonuclease G (ENDOG), three human housekeeping genes involved in mitochondrial biogenesis.