Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.26
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple myeloma 1332 1.9e-03
Waldenstrons macroglobulinemia 765 5.7e-03
Disease Target Count Z-score Confidence
Synovial sarcoma 25 4.161 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.221 1.9e-03
Waldenstrons macroglobulinemia 1.066 5.7e-03

AA Sequence

MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPT      1 - 70
STSKAME                                                                    71 - 77
//

Text Mined References (4)

PMID Year Title