Property Summary

NCBI Gene PubMed Count 49
PubMed Score 186.42
PubTator Score 54.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.012 2.1e-02
osteosarcoma -1.449 9.4e-06
group 3 medulloblastoma 1.700 3.8e-05
Pick disease -2.100 1.0e-06
progressive supranuclear palsy -1.600 6.8e-03
ovarian cancer -2.300 6.8e-11

Gene RIF (21)

PMID Text
25889056 The authors propose that splicing at 3'ss A3 is dependent on binding of the enhancing SR proteins SRSF2 and SRSF6 to the HIV-1 tat ESE and ESE2 sequence.
25889056 SRSF6 expression inhibits inclusion of exons 4cab and 5 into viral Rev and Nef-mRNAs by shifting a viral splice acceptor selection from 3'ss A5 to 3'ss A3 usage, leading to decreased levels of Rev and Nef proteins
24440982 SRSF6 is a regulator of wound healing and tissue homeostasis in skin.
23648111 Zinc inhibits the activity of SRSF6 and promotes elimination of exon 4, leading to preferential generation of BimS.
23132731 The splicing factor SRSF6 is an oncoprotein that regulates the proliferation and survival of lung and colon cancer cells.
22767602 Phosphorylation of SRp55 by Dyrk1A suppressed its ability to promote Tau exon 10 inclusion.
22516966 Report upregulation of Bim and the splicing factor SRp55 in melanoma cells from patients treated with selective BRAF inhibitors.
21345357 SRp55 aids in the generation of partially spliced and unspliced HIV-1 mRNAs.
21345357 SRSF6 expression inhibits inclusion of exons 4cab and 5 into viral Rev and Nef-mRNAs by shifting a viral splice acceptor selection from 3'ss A5 to 3'ss A3 usage, leading to decreased levels of Rev and Nef proteins
20685659 Serine- and arginine-rich proteins 55 and 75 (SRp55 and SRp75) induce production of HIV-1 vpr mRNA by inhibiting the 5'-splice site of exon 3.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20427542 Here, the authors report that specific SR proteins, particularly SRp40 and SRp55, promote human immunodeficiency virus type 1 (HIV-1) Gag translation from unspliced (intron-containing) viral RNA.
20427542 SRSF6 expression inhibits inclusion of exons 4cab and 5 into viral Rev and Nef-mRNAs by shifting a viral splice acceptor selection from 3'ss A5 to 3'ss A3 usage, leading to decreased levels of Rev and Nef proteins
19913121 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18854154 Knockdown of serine/arginine-rich splicing factor 6 (SRSF6) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18571879 These findings show that modulation of splicing activity in p53-deficient cells during the early response to sub-lethal DNA damage results in a change in the splicing of target genes, thus modifying the cellular response to genotoxic agents.
18315555 ASF/SF2 and SRp55 appear to interact with the variable TF exon 5 through exonic splicing enhancers at bases 39 and 87-117. Weakening of the above ESE modulates splicing of TF exon 5.
12779084 Higher relative expression of SR55 protein in breast tumors was associated with altered pattern of CD44 variants incorporating exon v7
12549914 SRp55 binding to a suboptimal RNA binding site in the calcitonin/CGRP pre-mRNA exonic splice enhancer, or increasing the amount of SRp55 in cells, is required for calcitonin mRNA production.
12531473 interacts with calcitonin/CGRP exon 4 exonic splice enhancer(ESE); binding of SRp55 to an ESE required for calcitonin mRNA splicing suggests that the different levels of SRp55 in different cell types may regulate calcitonin/CGRP alternative splicing

AA Sequence

MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHA      1 - 70
RGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYAD     71 - 140
AHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRR    141 - 210
SSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRS    211 - 280
PKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD          281 - 344
//

Text Mined References (57)

PMID Year Title
25889056 2015 Balanced splicing at the Tat-specific HIV-1 3'ss A3 is critical for HIV-1 replication.
25416956 2014 A proteome-scale map of the human interactome network.
24440982 2014 Splicing factor SRSF6 promotes hyperplasia of sensitized skin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23648111 2013 Zinc-induced modulation of SRSF6 activity alters Bim splicing to promote generation of the most potent apoptotic isoform BimS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23132731 2013 The splicing factor SRSF6 is amplified and is an oncoprotein in lung and colon cancers.
22767602 2012 Dual-specificity tyrosine phosphorylation-regulated kinase 1A (Dyrk1A) modulates serine/arginine-rich protein 55 (SRp55)-promoted Tau exon 10 inclusion.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22516966 2012 Evidence for upregulation of Bim and the splicing factor SRp55 in melanoma cells from patients treated with selective BRAF inhibitors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21345357 2011 Inhibition of splicing by serine-arginine rich protein 55 (SRp55) causes the appearance of partially spliced HIV-1 mRNAs in the cytoplasm.
21269460 2011 Initial characterization of the human central proteome.
20685659 2010 Serine- and arginine-rich proteins 55 and 75 (SRp55 and SRp75) induce production of HIV-1 vpr mRNA by inhibiting the 5'-splice site of exon 3.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
20427542 2010 SRp40 and SRp55 promote the translation of unspliced human immunodeficiency virus type 1 RNA.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19857271 2009 The SR protein family.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18571879 2008 Splicing and splice factor SRp55 participate in the response to DNA damage by changing isoform ratios of target genes.
18315555 2008 SR proteins ASF/SF2 and SRp55 participate in tissue factor biosynthesis in human monocytic cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17361132 2007 Unproductive splicing of SR genes associated with highly conserved and ultraconserved DNA elements.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15009664 2004 Tau exon 10, whose missplicing causes frontotemporal dementia, is regulated by an intricate interplay of cis elements and trans factors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12779084 2003 SR protein expression and CD44 splicing pattern in human breast tumours.
12549978 2003 Differential effects of hyperphosphorylation on splicing factor SRp55.
12549914 2003 SRp55 is a regulator of calcitonin/CGRP alternative RNA splicing.
12531473 2003 Human transformer 2beta and SRp55 interact with a calcitonin-specific splice enhancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
10983978 2000 Direct coupling of transcription and mRNA processing through the thermogenic coactivator PGC-1.
10757789 2000 Identification and characterization of a novel serine-arginine-rich splicing regulatory protein.
10340541 1999 A novel soluble chimera for the treatment of familial hypercholesterolemia.
10092085 1999 SF2 and SRp55 regulation of CD45 exon 4 skipping during T cell activation.
9649504 1998 Identification of functional exonic splicing enhancer motifs recognized by individual SR proteins.
9436904 1998 Specific binding of an exonic splicing enhancer by the pre-mRNA splicing factor SRp55.
8208298 1994 A serine kinase regulates intracellular localization of splicing factors in the cell cycle.
7651409 1995 A subset of SR proteins activates splicing of the cardiac troponin T alternative exon by direct interactions with an exonic enhancer.
7556075 1995 Identification and characterization of three members of the human SR family of pre-mRNA splicing factors.
1577277 1992 SR proteins: a conserved family of pre-mRNA splicing factors.