Tbio | Serine/arginine-rich splicing factor 5 |
Plays a role in constitutive splicing and can modulate the selection of alternative splice sites.
The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Liver diseases | 87 | 0.0 | 0.0 |
Neurotoxicity Syndromes | 26 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2890 | 3.2e-24 |
Breast cancer | 3578 | 1.7e-12 |
ovarian cancer | 8520 | 3.2e-07 |
Pick disease | 1894 | 5.5e-05 |
tuberculosis and treatment for 6 months | 409 | 2.3e-04 |
Waldenstrons macroglobulinemia | 765 | 6.3e-04 |
osteosarcoma | 7950 | 7.5e-04 |
progressive supranuclear palsy | 676 | 4.8e-03 |
Multiple myeloma | 1332 | 7.4e-03 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 1.0e-02 |
ependymoma | 4679 | 1.9e-02 |
colon cancer | 1478 | 2.0e-02 |
Alzheimer's disease | 658 | 4.1e-02 |
pancreatic cancer | 2398 | 4.4e-02 |
pancreatic carcinoma | 562 | 4.4e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Pyruvate decarboxylase deficiency | 16 | 3.486 | 1.7 |
Disease | log2 FC | p |
---|---|---|
Alzheimer's disease | -1.300 | 4.1e-02 |
Breast cancer | -1.200 | 1.7e-12 |
colon cancer | -1.200 | 2.0e-02 |
ependymoma | 1.200 | 1.9e-02 |
intraductal papillary-mucinous carcinoma... | 1.200 | 1.0e-02 |
Multiple myeloma | 1.035 | 7.4e-03 |
non-small cell lung cancer | -1.037 | 3.2e-24 |
osteosarcoma | -1.270 | 7.5e-04 |
ovarian cancer | -1.700 | 3.2e-07 |
pancreatic cancer | -1.900 | 4.4e-02 |
pancreatic carcinoma | -1.900 | 4.4e-02 |
Pick disease | -2.000 | 5.5e-05 |
progressive supranuclear palsy | -1.700 | 4.8e-03 |
tuberculosis and treatment for 6 months | 1.200 | 2.3e-04 |
Waldenstrons macroglobulinemia | 1.344 | 6.3e-04 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA |
MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGKELCSERVTIE 1 - 70 HARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQAGEVTFADAH 71 - 140 RPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRSRK 141 - 210 SYSRSRSRSRSRSRSKSRSVSRSPVPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN 211 - 272 //