Property Summary

NCBI Gene PubMed Count 75
PubMed Score 68.68
PubTator Score 67.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.648 7.8e-04
psoriasis -1.400 2.4e-04
group 3 medulloblastoma 2.000 4.6e-04
medulloblastoma, large-cell 1.400 1.3e-04
primitive neuroectodermal tumor 1.100 1.9e-03
acute quadriplegic myopathy 1.016 1.4e-06
non-small cell lung cancer -1.131 1.5e-17
Hydrolethalus syndrome -1.053 4.8e-02
Parkinson's disease -1.100 1.4e-02
posterior fossa group B ependymoma 1.100 1.2e-05
primary Sjogren syndrome 1.200 5.7e-03
subependymal giant cell astrocytoma -1.203 2.5e-02
Polycystic Ovary Syndrome 1.049 4.1e-02
invasive ductal carcinoma -1.400 3.0e-03
ovarian cancer -1.500 2.7e-07
pituitary cancer 1.100 7.2e-05

Gene RIF (41)

PMID Text
26876937 Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding.
26773498 We propose that SRSF3 could act as a coordinator of the expression of PDCD4 protein via two mechanisms on two alternatively spliced mRNA isoforms.
26704980 These data indicate that SRSF3 affects a global change of gene expression to maintain cell homeostasis.
26416554 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in oral squamous cell carcinoma cancer cells.
26367347 SRSF3 and hnRNP H1 are the first splicing factors identified which regulate the production of these functionally distinct HER2 splice variants and therefore maybe important for the regulation of HER2 signaling.
26282282 This new function of SRSF3 not only explains why overexpression of SRSF3 is required for ovarian cancer cell growth and survival but also offers a new insight into the mechanism of the neoplastic transformation.
26119931 we also demonstrated frequent co-overexpression and positive correlation of DARPP-32, SRp20 and CD44E expression levels in human gastric primary tumors.
25506695 Depletion of two of the most potent inhibitors of SMP2 exon 7 inclusion, SRSF2 or SRSF3, in cell lines derived from SMA patients, increased SMN2 exon 7 inclusion and SMN protein level.
25416801 SRSF3 (serine/arginine-rich splicing factor 3) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
25234929 Results identified modulation of SRSF3 activity as the molecular mechanism by which ORF57 promotes RNA splicing.
25132062 expression either decreased or the protein mislocalized in hepatocellular carcinoma
24321384 Therefore we conclude that SRSF3 promotes exon 9 skipping of caspase-2 pre-mRNA by interacting with exon 8
24292556 Data suggest that the oncogenic potential of SRSF3 might be realized, in part, through the translational repression of PDCD4 mRNA.
24284797 truncated SRSF3 protein may function as a positive regulator of oxidative stress-initiated inflammatory responses in colon cancer cells.
24190040 Stress-inducible truncated SRSF3 may participate in the acceleration of cell growth through facilitating c-Jun-mediated G1 progression under stressful conditions.
24190014 This is the first study that demonstrates that rs1122608 confers protection against ischemic stroke and implicates splicing factor SFSR3 in the disease process
23830997 Work described here examined the punctate pattern of SRp20 localization in the cytoplasm of poliovirus-infected cells, demonstrating the partial co-localization of SRp20 with the stress granule marker protein TIA-1.
23711097 Digoxin-mediated repression of SRSF3 expression plays a role in the digoxin-mediated inclusion of exon 20 in the IKBKAP transcript generated from the familial dysautonomia mutant allele.
23503458 findings disclose an important role of SRSF3 in the regulation of the G1-to-S-phase progression and alternative splicing of HIPK2 in tumor growth
23255796 results further define the mechanism of SRp20 cellular redistribution during picornavirus infections
23233666 Serine arginine splicing factor 3 is involved in enhanced splicing of glucose-6-phosphate dehydrogenase RNA in response to nutrients and hormones in liver
22921020 This study does not confirm a role for genetic variants in the SFRS3 and FKBP4 genes in the pathogenesis of corticosteroid-induced ocular hypertension.
22788679 This study found that significant changes in serine/arginine protein 20 (Srp20) gene expression in AD cases and confirmed this using a second cohort of control/AD.
22777358 downregulation of SRSF3 represents an endogenous mechanism for cellular senescence that directly regulates the TP53 alternative splicing to generate p53beta
22623141 Protein extracts of colon cancer CD133+ cell stem cells were compared to protein extracts of colon cancer cell CD133- stem cells by 2D DIGE. Demonstrated a direct cause-effect relationship between Wnt pathway activation & increased SRp20 expression.
22205602 Relative levels of SRp20, SRp30c, and SRp40 in TM cells control differential expression of the two alternatively spliced isoforms of the GR and thereby regulate GC responsiveness.
21779168 a model in which SRp20 interacts with PCBP2 bound to the viral RNA, and this interaction functions to recruit ribosomes to the viral RNA in a direct or indirect manner, with the participation of additional protein-protein or protein-RNA interactions.
21611201 Silencing of SFRS3 increased IL-1beta secretion due to elevation of IL-1beta and caspase-1 mRNA in addition to active caspase-1 levels.
21179588 Results suggest that increased SRp20 expression in tumor cells is a critical step for tumor initiation, progression, and maintenance.
20856201 expression of PTB and SRp20 is associated with malignancy of ovarian tumors but not with stage of invasive epithelial ovarian cancer
20810723 Epstein-Barr Virus SM protein utilizes cellular splicing factor SRp20 to mediate alternative splicing.
20376328 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20227104 The authors report that siRNA knockdown of SRp20 or 9G8 resulted in about a 10 fold decrease in herpes simplex virus 1 yields and in nuclear accumulation of polyA+ RNA.
19602482 ASF/SF2 and SRp20 are two antagonistic splicing factors regulating Rac1b expression in colorectal tumor cells.
19250906 SRp20 associate with interphase chromatin, and is released from hyperphosphorylated mitotic chromosomes
19047369 SRp20, SF2/ASF, and CUG-BP1 act antagonistically to regulate IR alternative splicing in vivo and that the relative ratios of SRp20 and SF2/ASF to CUG-BP1 in different cells determine the degree of exon inclusion.
18952824 Study reports the splicing factor SRp20 as a novel target gene of beta-catenin/TCF4 signaling.
18945760 abundant SRp20 in cancer cells or undifferentiated keratinocytes is important for the expression of the viral early E6 and E7 by promoting the expression of cellular transcription factor SP1 for transactivation of viral early promoters.
17183366 nucleo-cytoplasmic SR protein, SRp20, functions in internal ribosome entry site (IRES)-mediated translation of a viral RNA.
17028590 These results suggest that the C-terminal domain of RPB1 promotes exon skipping by recruiting SRp20 and that this contributes independently of elongation to the transcriptional control of alternative splicing.
15827065 insulin induces the proteasome-dependent degradation of SRp20 as well as the subnuclear relocalization of CLIC1

AA Sequence

MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRT      1 - 70
LCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLS     71 - 140
RERNHKPSRSFSRSRSRSRSNERK                                                  141 - 164
//

Text Mined References (85)

PMID Year Title
26876937 2016 Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing.
26773498 2016 SRSF3 represses the expression of PDCD4 protein by coordinated regulation of alternative splicing, export and translation.
26704980 2016 A genome landscape of SRSF3-regulated splicing events and gene expression in human osteosarcoma U2OS cells.
26416554 2015 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in cancer cells.
26367347 2015 SRSF3 and hnRNP H1 regulate a splicing hotspot of HER2 in breast cancer cells.
26282282 2015 Serine/arginine-rich splicing factor 3 (SRSF3) regulates homologous recombination-mediated DNA repair.
26119931 2016 Regulation of CD44E by DARPP-32-dependent activation of SRp20 splicing factor in gastric tumorigenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25506695 2014 Targeting SR proteins improves SMN expression in spinal muscular atrophy cells.
25234929 2014 Attenuation of the suppressive activity of cellular splicing factor SRSF3 by Kaposi sarcoma-associated herpesvirus ORF57 protein is required for RNA splicing.
25132062 2015 Deletion of serine/arginine-rich splicing factor 3 in hepatocytes predisposes to hepatocellular carcinoma in mice.
24321384 2014 Exon 9 skipping of apoptotic caspase-2 pre-mRNA is promoted by SRSF3 through interaction with exon 8.
24292556 2014 Splicing factor SRSF3 represses the translation of programmed cell death 4 mRNA by associating with the 5'-UTR region.
24284797 2014 Oxidative stress-inducible truncated serine/arginine-rich splicing factor 3 regulates interleukin-8 production in human colon cancer cells.
24190040 2013 Truncated serine/arginine-rich splicing factor 3 accelerates cell growth through up-regulating c-Jun expression.
24190014 2014 BRG1 variant rs1122608 on chromosome 19p13.2 confers protection against stroke and regulates expression of pre-mRNA-splicing factor SFRS3.
23830997 2013 Poliovirus infection induces the co-localization of cellular protein SRp20 with TIA-1, a cytoplasmic stress granule protein.
23711097 2013 Cardiac glycosides correct aberrant splicing of IKBKAP-encoded mRNA in familial dysautonomia derived cells by suppressing expression of SRSF3.
23503458 2014 Downregulation of serine/arginine-rich splicing factor 3 induces G1 cell cycle arrest and apoptosis in colon cancer cells.
23255796 2013 Viral proteinase requirements for the nucleocytoplasmic relocalization of cellular splicing factor SRp20 during picornavirus infections.
23233666 2013 Serine arginine splicing factor 3 is involved in enhanced splicing of glucose-6-phosphate dehydrogenase RNA in response to nutrients and hormones in liver.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22921020 2012 Analysis of single nucleotide polymorphisms in the SFRS3 and FKBP4 genes in corticosteroid-induced ocular hypertension.
22788679 2012 Srp20 regulates TrkB pre-mRNA splicing to generate TrkB-Shc transcripts with implications for Alzheimer's disease.
22777358 2013 Downregulation of splicing factor SRSF3 induces p53?, an alternatively spliced isoform of p53 that promotes cellular senescence.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22623141 2012 Protein cross-talk in CD133+ colon cancer cells indicates activation of the Wnt pathway and upregulation of SRp20 that is potentially involved in tumorigenicity.
22205602 2012 Spliceosome protein (SRp) regulation of glucocorticoid receptor isoforms and glucocorticoid response in human trabecular meshwork cells.
21779168 2011 Re-localization of cellular protein SRp20 during poliovirus infection: bridging a viral IRES to the host cell translation apparatus.
21611201 2011 An shRNA-based screen of splicing regulators identifies SFRS3 as a negative regulator of IL-1? secretion.
21269460 2011 Initial characterization of the human central proteome.
21179588 2010 SRp20 is a proto-oncogene critical for cell proliferation and tumor induction and maintenance.
20856201 2011 Knockdown of splicing factor SRp20 causes apoptosis in ovarian cancer cells and its expression is associated with malignancy of epithelial ovarian cancer.
20810723 2010 Epstein-Barr Virus SM protein utilizes cellular splicing factor SRp20 to mediate alternative splicing.
20639886 2010 Global analysis reveals SRp20- and SRp75-specific mRNPs in cycling and neural cells.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
20376328 2010 Assessment of SNPs associated with the human glucocorticoid receptor in primary open-angle glaucoma and steroid responders.
20227104 2010 SR proteins SRp20 and 9G8 contribute to efficient export of herpes simplex virus 1 mRNAs.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19857271 2009 The SR protein family.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19602482 2009 Antagonistic SR proteins regulate alternative splicing of tumor-related Rac1b downstream of the PI3-kinase and Wnt pathways.
19250906 2009 Chromatin binding of SRp20 and ASF/SF2 and dissociation from mitotic chromosomes is modulated by histone H3 serine 10 phosphorylation.
19047369 2009 SRp20 and CUG-BP1 modulate insulin receptor exon 11 alternative splicing.
18952824 2008 The beta-catenin/TCF4 pathway modifies alternative splicing through modulation of SRp20 expression.
18951082 2008 Death by splicing: tumor suppressor RBM5 freezes splice-site pairing.
18945760 2009 Control of the papillomavirus early-to-late switch by differentially expressed SRp20.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18364396 2008 Mutually exclusive interactions drive handover of mRNA from export adaptors to TAP.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17183366 2007 A nucleo-cytoplasmic SR protein functions in viral IRES-mediated translation initiation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17036044 2006 Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
17028590 2006 RNA polymerase II C-terminal domain mediates regulation of alternative splicing by SRp20.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16341674 2005 Transcriptome analysis of human gastric cancer.
15827065 2005 Proteomic analysis on insulin signaling in human hematopoietic cells: identification of CLIC1 and SRp20 as novel downstream effectors of insulin.
15595951 2004 The role of potential splicing factors including RBMY, RBMX, hnRNPG-T and STAR proteins in spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15231747 2004 A protein interaction framework for human mRNA degradation.
15169763 2004 Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12890497 2003 CHD1 associates with NCoR and histone deacetylase as well as with RNA splicing proteins.
12667464 2003 SR splicing factors serve as adapter proteins for TAP-dependent mRNA export.
12634307 Spermatogenetic expression of RNA-binding motif protein 7, a protein that interacts with splicing factors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991645 2002 Regulation of alternative splicing by SRrp86 through coactivation and repression of specific SR proteins.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11336712 2001 Splicing factors SRp20 and 9G8 promote the nucleocytoplasmic export of mRNA.
10823932 2000 A mammalian germ cell-specific RNA-binding protein interacts with ubiquitously expressed proteins involved in splice site selection.
10809782 2000 Interaction of two multifunctional proteins. Heterogeneous nuclear ribonucleoprotein K and Y-box-binding protein.
10757789 2000 Identification and characterization of a novel serine-arginine-rich splicing regulatory protein.
10390541 1999 SR protein-specific kinase 1 is highly expressed in testis and phosphorylates protamine 1.
9647638 1998 Physical map of human 6p21.2-6p21.3: region flanking the centromeric end of the major histocompatibility complex.
9447963 1998 Sip1, a novel RS domain-containing protein essential for pre-mRNA splicing.
9420331 1998 A specific subset of SR proteins shuttles continuously between the nucleus and the cytoplasm.
8208298 1994 A serine kinase regulates intracellular localization of splicing factors in the cell cycle.
7821789 1994 Construction of a human full-length cDNA bank.
2030943 1991 A differentially expressed murine RNA encoding a protein with similarities to two types of nucleic acid binding motifs.
1577277 1992 SR proteins: a conserved family of pre-mRNA splicing factors.