Property Summary

NCBI Gene PubMed Count 132
PubMed Score 295.18
PubTator Score 228.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.386 2.2e-04
osteosarcoma -1.087 2.2e-03
group 3 medulloblastoma 1.500 5.9e-05
astrocytoma 1.100 6.7e-03
glioblastoma 1.700 6.5e-04
medulloblastoma, large-cell 1.400 2.4e-06
lung cancer 1.100 7.3e-04
lung adenocarcinoma 1.020 1.5e-07
Pick disease -1.700 4.6e-07
progressive supranuclear palsy -1.200 6.8e-03
ovarian cancer 2.900 8.1e-07

Gene RIF (74)

PMID Text
26797131 NSrp70 acts as a new molecular counterpart for alternative splicing of target RNA, counteracting SRSF1 and SRSF2 splicing activity.
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
26534959 HIV-1-Tat Protein Inhibits SC35-mediated Tau Exon 10 Inclusion through Up-regulation of DYRK1A Kinase.
26406946 We present experimental evidence that splicing factor SRSF1, SRSF2, U2AF35, U2AF65 and KHSRP expression levels in gastrointestinal tract (colon, gastric and pancreatic) tumors differ compare to healthy tissues and in cell lines.
26261309 findings shed light on the mechanism of the disease-associated SRSF2 mutation in splicing regulation and also reveal a group of misspliced mRNA isoforms for potential therapeutic targeting
25964599 The mutational status of the SRSF2, U2AF1 and ZRSR2 did not affect the response rate or survival in MDS patients who had received first-line decitabine treatment.
25889056 The authors propose that splicing at 3'ss A3 is dependent on binding of the enhancing SR proteins SRSF2 and SRSF6 to the HIV-1 tat ESE and ESE2 sequence.
25889056 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
25765854 Our results show that diverse microenvironment cues affect different attributes of the SC-35 organizational metrics and lead to distinct emergent organizational patterns.
25717103 SRSF2 is required for expression of HPV16 E6E7 mRNAs in cervical tumor but not nontumor cells and may act by inhibiting their decay.
25553291 The genotype frequencies of SRSF2 SNP rs237057 were CT 7.6% and TT 92.4% in Childhood AML patients.
25550361 Mutation in SRSF2 gene is associated with secondary acute myeloid leukemia.
25541999 clinical relevance of SRSF2 mutations in Chinese myelodysplastic syndrome
25533824 SRSF2 mutations are frequent in chronic myelomonocytic leukemia patients, but show a relatively lower incidence in Chinese patients.
25506695 Depletion of two of the most potent inhibitors of SMP2 exon 7 inclusion, SRSF2 or SRSF3, in cell lines derived from SMA patients, increased SMN2 exon 7 inclusion and SMN protein level.
25496916 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
25445211 SRSF2 splicing factor gene mutations diagnose myelodysplastic syndromes.
25416801 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
25305095 SRSF2 mutations are frequent in chronic myelomonocytic leukemia and a useful diagnostic feature demonstrable in BM biopsies, allowing a definitive diagnosis for cases with minimal dysplasia and normal karyotype.
25231745 Molecular monitoring of patients having undergone AHSCT for PMF should not be restricted to JAK2, MPL or CALR, but all mutations present in primary fibrotic neoplastic myeloproliferation should be included to interpret abnormal blood values after AHSCT
25220236 SRSF2 promotes exon 11 inclusion of Ron proto-oncogene through targeting exon 11.
24813856 acts in concert with OCT4 and miRNAs to mediate protein diversity via alternative splicing enforcing a state of pluripotency
24796269 SETBP1 and SRSF2 are the most common somatic genetic abnormalities in patients with myeloid neoplasms carrying isochrmosome 17(q10), and may be important drivers of disease pathogenesis.
24792892 The SC35 exonic splicing enhancer motif is conserved within the same chromosome but not between different human chromosomes.
24406341 The SRSF2 is a unique SR protein that activates transcription in a position-dependent manner while three other SR proteins enhance translation in a position-independent fashion.
24389310 SRSF2-p95 hotspot mutation is highly associated with advanced forms of mastocytosis and mutations in epigenetic regulator genes.
24173428 SC35 promotes the production of the C5-V6-C6 isoform of CD44. Knockdown of SC35 reduces the expression of the CD44V6 isoform.
24115220 IDH mutations were closely associated with mutations of DNMT3A, ASXL1, and SRSF2, suggesting the interaction of IDH mutations with these gene aberrations may play a role in the development of MDS.
24037441 Protein kinase A interacts with and phosphorylates SC35 and enhances SC35-promoted tau exon 10 inclusion.
23660863 In primary myelofibrosis, SRSF2 mutation appears to be stable and not associated with progression from previous thrombocytosis to cytopenia.
23518498 A new function of the splicing factor SRSF2 in the control of E2F1-mediated cell cycle progression in neuroendocrine lung tumors.
23335386 SRSF2 is the most frequently mutated spliceosome gene in chronic myelomonocytic leukemia, but neither it nor SF3B1 or U2AF35 mutations are prognostically relevant.
23280334 data suggest that SF3B1, U2AF1 and SRSF2 mutations occur not only in myeloid lineage tumors but also in lymphoid lineage tumors; data suggest that the splicing gene mutations play important roles in the pathogenesis of hematologic tumors, but rarely in solid tumors
23065512 Data show that myelodysplastic chronic myelomonocytic leukemias are characterized by mutations in transcription/epigenetic regulators ASXL1, RUNX1, TET2 and SRSF2.
22968464 In 187 primary myelofibrosis patients, 17% had SRSF2 mutations at P95. They were associated with shorter survival.
22932795 SRSF2 mutation is associated with myelodysplastic syndrome.
22919025 SRSF2 mutations are associated with chronic myelomonocytic leukemia
22863587 Splicing factor SC35 might take part in the regulation of B7-H3 expression, which could help understand B7-H3 biological function.
22431577 SRSF2 mutations contribute to the pathogenesis of LT (leukemic transformation) and may guide novel therapeutic approaches for myeloproliferative neoplasms patients who undergo LT.
22389253 A negative prognostic impact of SRSF2 mutations in myelodysplastic syndromes. SRSF2 mutations may become useful for clinical risk stratification and treatment decisions in the future.
22323480 U2AF1 and SRSF2 mutations are frequent in chronic myelomonocytic leukemia and advanced forms of MDS. U2AF1 and SRSF2 mutations are predictive for shorter survival.
22238327 SF3B1, U2AF35, SRSF2 and NRAS mutation are unlikely to operate as driver mutations in patients with myelodysplastic syndrome or juvenile myelomonocytic leukemia.
22140111 The interactions involving the L3 loop, N- and C-termini of the RNA recognition motifs domain of SRSF2 are collectively important for determining selectivity between SRSF2 and RNA.
21333649 Data show that SC35 stabilized tau mRNA by binding to the SC35-like element of exon 10.
21157427 Acetylation and phosphorylation of SRSF2 control cell fate decision in response to cisplatin.
20615469 Amyloid-beta peptide alteration of tau exon-10 splicing is causally related to its activation of GSK-3beta which in turn phosphorylates SC35.
20580447 Most nuclei of TUNEL-positive myocytes in the fibrillating right atria express proliferating cell nuclear antigen, and most nuclei of TUNEL-positive myocytes also express SC-35; none express Ki-67.
20547768 SC35 is pivotal in RA-mediated PKCdelta pre-mRNA alternative splicing
19843576 SC35 antagonizes ASF/SF2 and SRp55 by competing for binding to certain sites in exon 5, thereby promoting TF exon 5 exclusion, an event unique to asTF biosynthesis.
19648116 complex formation between TBX5 and SC35
19177009 Results suggest that pri-miRNA/SC35-containing foci are not major sites of pri-miRNA processing and that pri-miRNA processing is coupled to transcription.
19005234 Dynamics of SC35 are significantly influenced by the organization of the compartment in which it is localized during the cell cycle.
18976975 Knockdown of serine/arginine-rich splicing factor 2 (SRSF2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18806759 E2F1 controls pre-mRNA processing events to induce apoptosis and identify the SC35 Ser-Rich Arg protein as a key direct E2F1-target in this setting.
18586677 Growth hormone deficiency and splicing fidelity: two serine/arginine-rich proteins, ASF/SF2 and SC35, act antagonistically
18025108 implicate SC35 as a key player in caffeine-mediated splicing regulation
17353911 This study demonstrates that binding of SC35 to Alu elements on either side of exon 7 in the transcribed pre-mRNA is involved in alternative splicing of amyloid precursor protein exons 7 and 8.
16990281 SC35, SRp40, and heterogeneous nuclear ribonucleoprotein A1 interact competitively at the HIV-1 Tat exon 2 splicing site
16761280 SC35 domains are hubs that spatially link expression of specific pre-mRNAs to rapid recycling of copious RNA metabolic complexes, thereby facilitating expression of many highly active genes.
15907217 SR proteins ASF/SF2, SC35 and 9G8 can down-regulate the late steps of HIV-1 replication via negative impact on RNA splicing and virion production.
15798212 The mutation responsible for aberrant splicing of the E1alpha PDH mRNA increases binding of the SC35 protein in patients with Leigh disease.
15511225 alphaB-crystallin has a phosphorylation-dependent role in the ubiquitination of a component of SC35 speckles
15208309 hnRNP A1 and ASF/SF2 and SC35 have antagonistic roles in splicing of beta-tropomyosin exon 6B
15123677 SR proteins 9G8, SC35, ASF/SF2, and SRp40 have effects on the utilization of the A1 to A5 splicing sites of HIV-1 RNA
14703516 hnRNP A1 binding to the exonic splicing silencer element inhibits splicing of the upstream intron by directly masking the SC35 binding site
12837281 CRYAB was preferentially localized to nuclear speckles as shown by colocalization with SC35.
12665590 role in c-H-ras alternative splicing regulation
12239324 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
11967326 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
11779509 exon identity established through differential antagonism between exonic splicing silencer-bound hnRNP A1 and enhancer-bound SR proteins
11090190 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
9601515 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
9541613 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences
7546906 SRSF2 and SRSF6 cooperatively activate HIV-1 Tat-specific 3'ss A3 site, either through two separate required mechanisms or by stabilizing each other on their respective target sequences

AA Sequence

MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED      1 - 70
AMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRS     71 - 140
RSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPP    141 - 210
KSPEEEGAVSS                                                               211 - 221
//

Text Mined References (144)

PMID Year Title
26797131 2016 Nuclear Speckle-related Protein 70 Binds to Serine/Arginine-rich Splicing Factors 1 and 2 via an Arginine/Serine-like Region and Counteracts Their Alternative Splicing Activity.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
26534959 2015 HIV-1-Tat Protein Inhibits SC35-mediated Tau Exon 10 Inclusion through Up-regulation of DYRK1A Kinase.
26406946 2015 Gastrointestinal tract tumors and cell lines possess differential splicing factor expression and tumor associated mRNA isoform formation profiles.
26261309 2015 Disease-associated mutation in SRSF2 misregulates splicing by altering RNA-binding affinities.
25964599 2015 Mutations in the Spliceosomal Machinery Genes SRSF2, U2AF1, and ZRSR2 and Response to Decitabine in Myelodysplastic Syndrome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25889056 2015 Balanced splicing at the Tat-specific HIV-1 3'ss A3 is critical for HIV-1 replication.
25765854 2015 Organizational metrics of interchromatin speckle factor domains: integrative classifier for stem cell adhesion & lineage signaling.
25717103 2015 Human Papillomavirus 16 Oncoprotein Expression Is Controlled by the Cellular Splicing Factor SRSF2 (SC35).
25553291 2015 Alteration of the SETBP1 gene and splicing pathway genes SF3B1, U2AF1, and SRSF2 in childhood acute myeloid leukemia.
25550361 2015 Acute myeloid leukemia ontogeny is defined by distinct somatic mutations.
25541999 2014 Detection of SRSF2-P95 mutation by high-resolution melting curve analysis and its effect on prognosis in myelodysplastic syndrome.
25533824 2014 Clinical manifestation of the SRSF2 gene mutation in Chinese patients with chronic myelomonocytic leukemia.
25506695 2014 Targeting SR proteins improves SMN expression in spinal muscular atrophy cells.
25445211 2015 Development of a high-resolution melting curve analysis screening test for SRSF2 splicing factor gene mutations in myelodysplastic syndromes.
25305095 2014 The detection of SRSF2 mutations in routinely processed bone marrow biopsies is useful in the diagnosis of chronic myelomonocytic leukemia.
25231745 2015 SRSF2 and U2AF1 mutations in primary myelofibrosis are associated with JAK2 and MPL but not calreticulin mutation and may independently reoccur after allogeneic stem cell transplantation.
25220236 2014 SRSF2 promotes splicing and transcription of exon 11 included isoform in Ron proto-oncogene.
24813856 2014 Alternative splicing of MBD2 supports self-renewal in human pluripotent stem cells.
24796269 2014 Clinicopathologic and molecular characterization of myeloid neoplasms harboring isochromosome 17(q10).
24792892 2014 Slight variations in the SC35 ESE sequence motif among human chromosomes: a computational approach.
24406341 Unique role of SRSF2 in transcription activation and diverse functions of the SR and hnRNP proteins in gene expression regulation.
24389310 2014 SRSF2-p95 hotspot mutation is highly associated with advanced forms of mastocytosis and mutations in epigenetic regulator genes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24173428 2014 SC35 promotes splicing of the C5-V6-C6 isoform of CD44 pre-mRNA.
24115220 2014 IDH mutations are closely associated with mutations of DNMT3A, ASXL1 and SRSF2 in patients with myelodysplastic syndromes and are stable during disease evolution.
24037441 2014 Cyclic AMP-dependent protein kinase enhances SC35-promoted Tau exon 10 inclusion.
23776548 2013 Genetic loci for retinal arteriolar microcirculation.
23660863 2013 SRSF2 mutation is present in the hypercellular and prefibrotic stage of primary myelofibrosis.
23562910 2013 Loss of FMR2 further emphasizes the link between deregulation of immediate early response genes FOS and JUN and intellectual disability.
23518498 2013 A new function of the splicing factor SRSF2 in the control of E2F1-mediated cell cycle progression in neuroendocrine lung tumors.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23335386 2013 Spliceosome mutations involving SRSF2, SF3B1, and U2AF35 in chronic myelomonocytic leukemia: prevalence, clinical correlates, and prognostic relevance.
23280334 2013 Mutational analysis of splicing machinery genes SF3B1, U2AF1 and SRSF2 in myelodysplasia and other common tumors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23065512 2013 Molecular similarity between myelodysplastic form of chronic myelomonocytic leukemia and refractory anemia with ring sideroblasts.
22968464 2012 SRSF2 mutations in primary myelofibrosis: significant clustering with IDH mutations and independent association with inferior overall and leukemia-free survival.
22932795 2012 The clinical implication of SRSF2 mutation in patients with myelodysplastic syndrome and its stability during disease evolution.
22919025 2012 SRSF2 mutations in 275 cases with chronic myelomonocytic leukemia (CMML).
22863587 2012 [Splicing factor SC35 regulated the expression of B7-H3 in vitro].
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22431577 2012 Genetic analysis of patients with leukemic transformation of myeloproliferative neoplasms shows recurrent SRSF2 mutations that are associated with adverse outcome.
22389253 2012 Frequency and prognostic impact of mutations in SRSF2, U2AF1, and ZRSR2 in patients with myelodysplastic syndromes.
22323480 2012 Mutations in the spliceosome machinery, a novel and ubiquitous pathway in leukemogenesis.
22238327 2012 Spliceosomal gene aberrations are rare, coexist with oncogenic mutations, and are unlikely to exert a driver effect in childhood MDS and JMML.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22140111 2012 The structure and selectivity of the SR protein SRSF2 RRM domain with RNA.
21984414 2012 The RNA recognition motif protein RBM11 is a novel tissue-specific splicing regulator.
21653549 2011 The human DEK oncogene regulates DNA damage response signaling and repair.
21504830 2011 SON controls cell-cycle progression by coordinated regulation of RNA splicing.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21333649 2011 Splicing factor SC35 promotes tau expression through stabilization of its mRNA.
21296756 2011 NSrp70 is a novel nuclear speckle-related protein that modulates alternative pre-mRNA splicing in vivo.
21269460 2011 Initial characterization of the human central proteome.
21157427 2011 Acetylation and phosphorylation of SRSF2 control cell fate decision in response to cisplatin.
20703835 2011 The 1H, 13C and 15N backbone and side-chain assignment of the RRM domain of SC35, a regulator of pre-mRNA splicing.
20615469 2010 Amyloid-? peptide alteration of tau exon-10 splicing via the GSK3?-SC35 pathway.
20580447 2011 Expression of spliceosome assembly factor SC-35 in TUNEL-positive atrial cardiomyocytes in mitral and tricuspid regurgitation: viability of atrial cardiomyocytes.
20547768 2010 Vitamin A metabolite, all-trans-retinoic acid, mediates alternative splicing of protein kinase C deltaVIII (PKCdeltaVIII) isoform via splicing factor SC35.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19857271 2009 The SR protein family.
19843576 2010 Antagonistic roles of four SR proteins in the biosynthesis of alternatively spliced tissue factor transcripts in monocytic cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19648116 2009 Functional role of transcriptional factor TBX5 in pre-mRNA splicing and Holt-Oram syndrome via association with SC35.
19592491 2009 Interaction of Akt-phosphorylated SRPK2 with 14-3-3 mediates cell cycle and cell death in neurons.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19177009 2009 Subnuclear compartmentalization of transiently expressed polyadenylated pri-microRNAs: processing at transcription sites or accumulation in SC35 foci.
19005234 2008 Differential dynamics of splicing factor SC35 during the cell cycle.
18806759 2008 E2F1 controls alternative splicing pattern of genes involved in apoptosis through upregulation of the splicing factor SC35.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18586677 2008 Growth hormone deficiency and splicing fidelity: two serine/arginine-rich proteins, ASF/SF2 and SC35, act antagonistically.
18025108 2008 Caffeine regulates alternative splicing in a subset of cancer-associated genes: a role for SC35.
17494991 2007 Characterization of cyclin L1 as an immobile component of the splicing factor compartment.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17353911 2007 A role for SC35 and hnRNPA1 in the determination of amyloid precursor protein isoforms.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16990281 2006 Biochemical and NMR study on the competition between proteins SC35, SRp40, and heterogeneous nuclear ribonucleoprotein A1 at the HIV-1 Tat exon 2 splicing site.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16761280 2006 Molecular anatomy of a speckle.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15988025 2005 HiNF-P directly links the cyclin E/CDK2/p220NPAT pathway to histone H4 gene regulation at the G1/S phase cell cycle transition.
15907217 2005 Dual effect of the SR proteins ASF/SF2, SC35 and 9G8 on HIV-1 RNA splicing and virion production.
15798212 2005 The SR protein SC35 is responsible for aberrant splicing of the E1alpha pyruvate dehydrogenase mRNA in a case of mental retardation with lactic acidosis.
15798186 2005 A novel SR-related protein is required for the second step of Pre-mRNA splicing.
15652350 2005 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing.
15511225 2004 Mimicking phosphorylation of the small heat-shock protein alphaB-crystallin recruits the F-box protein FBX4 to nuclear SC35 speckles.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15208309 2004 hnRNP A1 and the SR proteins ASF/SF2 and SC35 have antagonistic functions in splicing of beta-tropomyosin exon 6B.
15123677 2004 Differential effects of the SR proteins 9G8, SC35, ASF/SF2, and SRp40 on the utilization of the A1 to A5 splicing sites of HIV-1 RNA.
14703516 2004 SC35 and heterogeneous nuclear ribonucleoprotein A/B proteins bind to a juxtaposed exonic splicing enhancer/exonic splicing silencer element to regulate HIV-1 tat exon 2 splicing.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684736 2004 Cyclin L2, a novel RNA polymerase II-associated cyclin, is involved in pre-mRNA splicing and induces apoptosis of human hepatocellular carcinoma cells.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12837281 2003 Nuclear speckle localisation of the small heat shock protein alpha B-crystallin and its inhibition by the R120G cardiomyopathy-linked mutation.
12799190 2003 Diacylglycerol kinase-theta is localized in the speckle domains of the nucleus.
12665590 2003 Roles of hnRNP A1, SR proteins, and p68 helicase in c-H-ras alternative splicing regulation.
12565890 2003 Centaurin-alpha 1 associates in vitro and in vivo with nucleolin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239324 2002 Rev inhibition strongly affects intracellular distribution of human immunodeficiency virus type 1 RNAs.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991645 2002 Regulation of alternative splicing by SRrp86 through coactivation and repression of specific SR proteins.
11980906 2002 Cyclin L is an RS domain protein involved in pre-mRNA splicing.
11967326 2002 Positive and negative modulation of human immunodeficiency virus type 1 Rev function by cis and trans regulators of viral RNA splicing.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11779509 2001 Exon identity established through differential antagonism between exonic splicing silencer-bound hnRNP A1 and enhancer-bound SR proteins.
11683997 2001 Dopamine and glutamate induce distinct striatal splice forms of Ania-6, an RNA polymerase II-associated cyclin.
11683387 2001 CrkRS: a novel conserved Cdc2-related protein kinase that colocalises with SC35 speckles.
11448987 2001 ZNF265--a novel spliceosomal protein able to induce alternative splicing.
11313942 2001 PRCC, the commonest TFE3 fusion partner in papillary renal carcinoma is associated with pre-mRNA splicing factors.
11239462 2001 SC35 plays a role in T cell development and alternative splicing of CD45.
11101696 2000 Uterine expression of alternatively spliced mRNAs of mouse splicing factor SC35 during early pregnancy.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
11090190 2000 Identification of a domain in human immunodeficiency virus type 1 rev that is required for functional activity and modulates association with subnuclear compartments containing splicing factor SC35.
10893273 2000 CREB-binding protein (CBP)/p300 and RNA polymerase II colocalize in transcriptionally active domains in the nucleus.
10757789 2000 Identification and characterization of a novel serine-arginine-rich splicing regulatory protein.
10082253 1999 Immunolabelling of spliceosomes in sections and cultured astrocytes of human fetal brain tissue.
9774382 1998 Oncoprotein TLS interacts with serine-arginine proteins involved in RNA splicing.
9601515 1998 Subcellular localization of human immunodeficiency virus type 1 RNAs, Rev, and the splicing factor SC-35.
9541613 1998 Histographic recording of human immunodeficiency virus type 1 (HIV-1) regulatory protein Rev and nuclear factors.
9513048 1998 Dynamics of distribution of splicing components relative to the transcriptional state of human oocytes from antral follicles.
9473574 1998 Cloning of a gene, YT521, for a novel RNA splicing-related protein induced by hypoxia/reoxygenation.
9447963 1998 Sip1, a novel RS domain-containing protein essential for pre-mRNA splicing.
9358160 1997 Characterization of multiple alternative RNAs resulting from antisense transcription of the PR264/SC35 splicing factor gene.
9237760 1997 A protein related to splicing factor U2AF35 that interacts with U2AF65 and SR proteins in splicing of pre-mRNA.
8816452 1996 Functional properties of p54, a novel SR protein active in constitutive and alternative splicing.
8530103 1995 Chromosomal localization of mouse and human genes encoding the splicing factors ASF/SF2 (SFRS1) and SC-35 (SFRS2).
8361546 1993 Specific commitment of different pre-mRNAs to splicing by single SR proteins.
8302870 1994 Several mRNAs with variable 3' untranslated regions and different stability encode the human PR264/SC35 splicing factor.
8261509 1993 Specific interactions between proteins implicated in splice site selection and regulated alternative splicing.
8139654 1994 Protein-protein interactions and 5'-splice-site recognition in mammalian mRNA precursors.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7546906 1995 Localization of human immunodeficiency virus Rev in transfected and virus-infected cells.
7543047 1995 The human splicing factors ASF/SF2 and SC35 possess distinct, functionally significant RNA binding specificities.
3031469 1987 Analysis of mutation in human cells by using an Epstein-Barr virus shuttle system.
1577277 1992 SR proteins: a conserved family of pre-mRNA splicing factors.
1557353 1992 A potential splicing factor is encoded by the opposite strand of the trans-spliced c-myb exon.
1465383 1992 The PR264/c-myb connection: expression of a splicing factor modulated by a nuclear protooncogene.
1373910 1992 Isolation of a complementary DNA that encodes the mammalian splicing factor SC35.