Property Summary

NCBI Gene PubMed Count 33
PubMed Score 58.22
PubTator Score 36.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.400 1.4e-03
hepatocellular carcinoma 1.400 1.8e-05
pancreatic cancer 1.500 1.3e-03
Multiple myeloma 1.147 2.3e-04
oligodendroglioma -1.500 3.8e-02
psoriasis -1.500 1.2e-04
osteosarcoma 2.195 1.1e-04
glioblastoma 1.400 1.3e-03
group 3 medulloblastoma 1.700 4.3e-04
atypical teratoid / rhabdoid tumor -1.200 8.4e-03
medulloblastoma, large-cell 1.200 1.7e-04
primitive neuroectodermal tumor 1.300 4.7e-04
acute quadriplegic myopathy 1.109 1.5e-05
intraductal papillary-mucinous adenoma (... 1.100 2.1e-03
intraductal papillary-mucinous carcinoma... 1.200 1.4e-04
pediatric high grade glioma 1.100 2.0e-03
pancreatic carcinoma 1.500 1.3e-03
aldosterone-producing adenoma -1.032 4.6e-02
nasopharyngeal carcinoma 1.400 3.0e-04
lung adenocarcinoma 1.205 1.8e-06
ovarian cancer 2.200 3.2e-05

 GWAS Trait (1)

Gene RIF (10)

PMID Text
26876937 Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding.
25091051 SRSF10 is a key regulator of BCLAF1 pre-mRNA splicing and the maintenance of oncogenic features in human colon cancer cells
23166591 Tandem affinity purification and mass spectrometry analysis identify serine/arginine-rich splicing factor 10 (SRSF10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify serine/arginine-rich splicing factor 10 (SRSF10), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21984158 In colorectal cancer, NSSR1 was highly expressed in the nucleus of tumor cells.
21135127 Splicing thermotolerance is acquired through maintenance of SRSF10 phosphorylation and that this is mediated at least in part by Hsp27.
20232416 Data show that SFRS13A expression was significantly associated with LDLR splicing efficiency in vivo.
16135820 SRp38 contains two arginine- and serine-rich domains (RS), one of which has a unique, second-step repression activity, while both function together as a splicing repression domain.
14765198 SRp38 plays a crucial role in cell survival under stress conditions by inhibiting the splicing machinery
12419250 found to be dephosphorylated specifically in mitotic cells; show that dephosphorylated SRp38 is required for the observed splicing repression

AA Sequence

MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN      1 - 70
LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR     71 - 140
SYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSK    141 - 210
TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH                      211 - 262
//

Text Mined References (41)

PMID Year Title
26876937 2016 Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25091051 2014 BCLAF1 and its splicing regulator SRSF10 regulate the tumorigenic potential of colon cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21984158 2011 [Expression of neural salient serine-/arginine-rich protein 1 (NSSR1) in colorectal cancer].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21135127 2011 Heat shock-induced SRSF10 dephosphorylation displays thermotolerance mediated by Hsp27.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
20232416 2010 Role of SFRS13A in low-density lipoprotein receptor splicing.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17936706 2007 A complex signaling pathway regulates SRp38 phosphorylation and pre-mRNA splicing in response to heat shock.
17361132 2007 Unproductive splicing of SR genes associated with highly conserved and ultraconserved DNA elements.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16135820 2005 Multiple properties of the splicing repressor SRp38 distinguish it from typical SR proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14765198 2004 Dephosphorylated SRp38 acts as a splicing repressor in response to heat shock.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419250 2002 The SR protein SRp38 represses splicing in M phase cells.
11891055 2002 Characterization and expression of the human gene encoding two translocation liposarcoma protein-associated serine-arginine (TASR) proteins.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11684676 2001 Serine-arginine (SR) protein-like factors that antagonize authentic SR proteins and regulate alternative splicing.
10779324 2000 TLS-ERG leukemia fusion protein inhibits RNA splicing mediated by serine-arginine proteins.
10583508 1999 Cloning and characterization of two neural-salient serine/arginine-rich (NSSR) proteins involved in the regulation of alternative splicing in neurones.
9774382 1998 Oncoprotein TLS interacts with serine-arginine proteins involved in RNA splicing.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.