Property Summary

NCBI Gene PubMed Count 31
PubMed Score 100.97
PubTator Score 28.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.100 6.6e-06
ependymoma 1.200 3.6e-02
oligodendroglioma 1.100 5.3e-03
psoriasis -1.800 6.3e-04
osteosarcoma -1.239 1.6e-04
astrocytoma 1.600 3.7e-03
pancreatic ductal adenocarcinoma liver m... 1.207 8.2e-03
group 3 medulloblastoma 1.200 5.7e-04
ovarian cancer 2.200 6.9e-07
Gaucher disease type 1 -1.300 3.2e-02

 GO Component (2)

Protein-protein Interaction (223)

ELL2   U2SURP   POLR2D   DHX15   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   CCNT1   CCNT2   PQBP1   PRPF40A   SF3B1   WBP4   SNRNP200   CCNK   BCAS2   DNAJC8   SMNDC1   SNAPC5   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SP1   SNRPB2   SNRNP70   SNRPA   POU2F2   SNRPC   HNRNPA1   SNRPA1   HSPA8   GTF2F2   SNRPB   POU2F1   HNRNPL   DDX5   POLR2C   POLR2E   TBP   HNRNPA2B1   POLR2A   U2AF2   PTBP1   GTF2E1   GTF2E2   POLR2B   HNRNPH1   CSTF2   GTF2F1   FUS   POLR2I   RBMX   EIF4A3   BUD31   TAF6   CDK7   CDK9   PAPOLA   HNRNPA3   HNRNPM   NCBP2   POLR2H   POLR2J   HNRNPF   GTF2A1   GTF2A2   ZNF143   RBM5   POLR2K   ELL   SNU13   HNRNPH2   POLR2F   MAGOH   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   POLR2G   POLR2L   TRA2B   SNURF   YBX1   TXNL4A   SRSF3   GTF2B   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF11   SRSF1   SRSF4   DHX9   NCBP1   CPSF1   SF3A3   ELAVL2   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   SNAPC2   SNW1   HNRNPD   EFTUD2   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   TAF5   TAF13   TAF11   SF1   ELAVL1   SNAPC1   TAF9   SRSF7   USP39   SNAPC4   CPSF3L   RPRD2   ICE2   INTS3   PRPF8   INTS5   FIP1L1   CWC27   INTS8   DDX46   PHF5A   TAF8   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   RPAP2   SRRM1   INTS1   ZC3H8   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   CTNNBL1   DHX38   PRCC   SYMPK   GPKOW   SNAPC3   CLP1   MAGOHB   NABP1   PPWD1   INTS12   SNRNP40   INTS4   RBM17   RPRD1A   VWA9   CDC5L   NABP2   HNRNPUL1   DDX23   SF3B5   UPF3B   CRNKL1   WDR33   INTS2   CSTF2T   PHAX   ELL3   CWC22   XAB2   RPRD1B   INTS9   INTS7   ASUN   INTS10   RBM22   CWC25   CWC15   CPSF2   PUF60   LSM7   CPSF3   INTS6   ISY1   PRPF19   PPIE   SRRM2   ICE1   WBP11   LSM2   SF3B6   PPIL1   LSM5   LSM4   RBM8A  

Gene RIF (10)

PMID Text
25530566 ARS2 and CASP8AP2 expressions can precisely predict high-risk of relapse and ALL prognosis.
24272391 Ars2 is overexpressed in HCC and may have prognostic value; it might play an important role in HCC proliferation and miR-21 expression.
22244333 Ars2 contributes to histone mRNA 3' end formation and expression and these functional properties of Ars2 are negatively regulated by interaction with 7SK RNA.
22213145 Ars2 is overexpressed in human cholangiocarcinoma and may be a diagnostic marker. Ars2 depletion increases PTEN and PDCD4 protein levels via the reduction of miR-21.
19632182 These findings provide evidence for a role for Ars2 in RNA interference regulation during cell proliferation.
19546234 Results suggest that FLASH functions in S phase progression through interaction with ARS2.
18854154 Knockdown of serrate RNA effector molecule homolog (SRRT) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18086880 These data indicate ARS2 is essential for early mammalian development and is likely involved in an essential cellular process.
17672918 Validated occurrence of an unusual TG 3' splice site in intron 17 (NM_015908).
10069470 Nomenclature. Original paper and GenBank submission by Rossman and Wang (1999) called the gene Asr2 (arsenite resistance protein 2) as opposed to Ars2 (arsenate resistance protein 2).

AA Sequence

MGDSDDEYDRRRRDKFRRERSDYDRSRERDERRRGDDWNDREWDRGRERRSRGEYRDYDRNRRERFSPPR      1 - 70
HELSPPQKRMRRDWDEHSSDPYHSGYEMPYAGGGGGPTYGPPQPWGHPDVHIMQHHVLPIQARLGSIAEI     71 - 140
DLGVPPPVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRR    141 - 210
QEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRILEQEEEEEQAGKP    211 - 280
GEPSKKEEGRAGAGLGDGERKTNDKDEKKEDGKQAENDSSNDDKTKKSEGDGDKEEKKEDSEKEAKKSSK    281 - 350
KRNRKHSGDDSFDEGSVSESESESESGQAEEEKEEAEEALKEKEKPKEEEWEKPKDAAGLECKPRPLHKT    351 - 420
CSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLREC    421 - 490
ELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPLPTSLPSQNPILKN    491 - 560
ITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEY    561 - 630
PNEDEMPNRCGIIHVRGPMPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKF    631 - 700
VTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQP    701 - 770
PGPAQILPPGLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFR    771 - 840
GQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF                                      841 - 876
//

Text Mined References (45)

PMID Year Title
26382858 2015 mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25530566 2015 Low expressions of ARS2 and CASP8AP2 predict relapse and poor prognosis in pediatric acute lymphoblastic leukemia patients treated on China CCLG-ALL 2008 protocol.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24272391 2014 Expression and prognostic value of Ars2 in hepatocellular carcinoma.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990020 2012 Genome-wide association study for circulating levels of PAI-1 provides novel insights into its regulation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22244333 2012 Ars2 promotes proper replication-dependent histone mRNA 3' end formation.
22213145 2013 Ars2 is overexpressed in human cholangiocarcinomas and its depletion increases PTEN and PDCD4 by decreasing microRNA-21.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20858735 2010 Interactions of ErbB4 and Kap1 connect the growth factor and DNA damage response pathways.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19632182 2009 Ars2 links the nuclear cap-binding complex to RNA interference and cell proliferation.
19546234 2009 Interaction of FLASH with arsenite resistance protein 2 is involved in cell cycle progression at S phase.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18086880 2008 ARS2 is a conserved eukaryotic gene essential for early mammalian development.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12869526 2003 HCC-associated protein HCAP1, a variant of GEMIN4, interacts with zinc-finger proteins.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11239002 2001 Comparative analysis of the gene-dense ACHE/TFR2 region on human chromosome 7q22 with the orthologous region on mouse chromosome 5.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10069470 1999 Expression cloning for arsenite-resistance resulted in isolation of tumor-suppressor fau cDNA: possible involvement of the ubiquitin system in arsenic carcinogenesis.