Property Summary

NCBI Gene PubMed Count 34
PubMed Score 123.26
PubTator Score 20.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 2.019 2.8e-04
acute quadriplegic myopathy 1.125 1.4e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.4e-02
acute myeloid leukemia 1.400 2.3e-02
ovarian cancer -1.100 3.9e-04

Gene RIF (7)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human serine/arginine repetitive matrix 1 (SRRM1) at amino acid residues 123-124 by the HIV-1 protease
16354706 SRm160, a splicing coactivator, regulates CD44 alternative splicing in a Ras-dependent manner.
16159877 found that the majority of proteins identified in SRm160-containing complexes are associated with pre-mRNA processing. Interestingly, SRm160 is also associated with factors involved in chromatin regulation and sister chromatid cohesion
15024032 Data show that SRm160, a splicing coactivator and component of the exon junction complex (EJC) involved in RNA export, has an adenosine triphosphate (ATP)-dependent mobility.
12624182 two contiguous sequences that independently target SRm160 to nuclear matrix sites at splicing speckled domains: amino acids 300-350 and 351-688
12581738 Proto-oncoprotein TLS/FUS is associated to the nuclear matrix and complexed with splicing factors PTB, SRm160, and SR proteins and plays a role in spliceosome assembly
11991360 1H, 13C, and 15N resonance assignments and secondary structure of the PWI domain from SRm160 was determined using reduced dimensionality NMR.

AA Sequence

MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEF      1 - 70
IFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEK     71 - 140
LASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSP    141 - 210
SPAPEKKEKTPELPEPSVKVKEPSVQEATSTSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRS    211 - 280
RSKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRR    281 - 350
SSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQS    351 - 420
NRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQQRRQYRRQNQ    421 - 490
QSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRS    491 - 560
PSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPP    561 - 630
PKRRVSHSPPPKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPV    631 - 700
RRGASSSPQRRQSPSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSP    701 - 770
VQSQSPSTNWSPAVPVKKAKSPTPSPSPPRNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAA    771 - 840
AAAAVTPAAIAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVSPQS          841 - 904
//

Text Mined References (50)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16354706 2006 Regulation of CD44 alternative splicing by SRm160 and its potential role in tumor cell invasion.
16159877 2005 Proteomic analysis of SRm160-containing complexes reveals a conserved association with cohesin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15024032 2004 In vitro FRAP reveals the ATP-dependent nuclear mobilization of the exon junction complex protein SRm160.
12944400 2003 An evolutionarily conserved role for SRm160 in 3'-end processing that functions independently of exon junction complex formation.
12624182 2003 The spatial targeting and nuclear matrix binding domains of SRm160.
12600940 2003 Structure and function of the PWI motif: a novel nucleic acid-binding domain that facilitates pre-mRNA processing.
12581738 2003 Proto-oncoprotein TLS/FUS is associated to the nuclear matrix and complexed with splicing factors PTB, SRm160, and SR proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12093754 2002 The exon junction complex is detected on CBP80-bound but not eIF4E-bound mRNA in mammalian cells: dynamics of mRNP remodeling.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11991360 2002 1H, 13C, and 15N resonance assignments and secondary structure of the PWI domain from SRm160 using reduced dimensionality NMR.
11739730 2002 SRm160 splicing coactivator promotes transcript 3'-end cleavage.
11546874 2001 Communication of the position of exon-exon junctions to the mRNA surveillance machinery by the protein RNPS1.
11118221 2000 The spliceosome deposits multiple proteins 20-24 nucleotides upstream of mRNA exon-exon junctions.
10908574 2000 The acute myeloid leukemia-associated protein, DEK, forms a splicing-dependent interaction with exon-product complexes.
10809668 2000 Pre-mRNA splicing alters mRNP composition: evidence for stable association of proteins at exon-exon junctions.
10668804 2000 The SRm160/300 splicing coactivator subunits.
10339552 1999 The SRm160/300 splicing coactivator is required for exon-enhancer function.
9933612 1999 The nuclear cap-binding complex is a novel target of growth factor receptor-coupled signal transduction.
9531537 1998 A coactivator of pre-mRNA splicing.
9472028 1998 SRPK2: a differentially expressed SR protein-specific kinase involved in mediating the interaction and localization of pre-mRNA splicing factors in mammalian cells.