Property Summary

NCBI Gene PubMed Count 43
PubMed Score 413.77
PubTator Score 123.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.500 1.7e-03
osteosarcoma -2.177 1.4e-03
posterior fossa group B ependymoma 1.500 3.3e-08
medulloblastoma, large-cell -1.600 1.1e-02
intraductal papillary-mucinous carcinoma... -1.100 1.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-02
lung cancer 1.700 2.4e-04
group 3 medulloblastoma 1.200 2.4e-02
aldosterone-producing adenoma -1.091 9.6e-03
pituitary cancer 1.300 1.8e-04

Protein-protein Interaction (1)

Gene RIF (28)

PMID Text
26913720 MiR-193a-3p and miR-193a-5p play important roles in osteosarcoma metastasis through down-regulation of the Rab27B and SRR genes and therefore may serve as useful biomarkers for the diagnosis of osteosarcoma
26485193 Loss-of-function mutation of the gene encoding serine racemase significantly attenuates excitotoxicity in retina.
25493718 In serine racemase, similarly to the related enzyme alanine racemase, the unprotonated pyridoxal-5'-phosphate -substrate intermediate is stabilized mostly due to solvation effects contributed by water molecules and active-site residues.
25336657 FBXO22 protein is required for optimal synthesis of NMDA receptor coagonist D-serine by interacting with serine racemase, activating it, and preventing its targeting to membranes.
25331425 Serine racemase activity and dynamics are regulated by halides, ATP and malonate.
23992455 cross-talk between allosteric and active sites, leading to the stabilization of two alternative protein conformations with ATP affinities of ~ 10 muM and 1.8 mm
23112234 S84A serine racemase mutant behaved like serine dehydratase, whereas A65S serine dehydratase mutant acquired an additional function of using D-serine as a substrate.
22151352 The structural characteristics of SR obtained from live cells suggest that SR is sensitive to oxidation in vivo, perhaps consistent with a scenario in which such modification plays a role in feedback or other forms of regulation.
22117694 Serine racemase and D-serine are involved in both pre-symptomatic and progressive phases of amyotrophic lateral sclerosis, demonstrating a link between mutant superoxide dismutase (SOD)1 and a glial-derived toxic mediator in transgenic mice.
22096510 Six SNP(rs7754840 in CDKAL1, rs391300 in SRR, rs2383208 in CDKN2A/2B, rs4402960 in IGF2BP2, rs10830963 in MTNR1B, rs4607517 in GCK)risk alleles of type 2 diabetes were associated with GDM in pregnant Chinese women.
20385472 The SRR mRNA is elevated in people death with suicide.
20174558 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20106978 The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19483194 Analysis of SRR genetic variants in humans identified a robust association with schizophrenia.
19223009 Observational study of gene-disease association. (HuGE Navigator)
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
17880399 serine racemase and D-amino acid oxidase are expressed in human brain and demonstrate aberrant D-serine metabolism in schizophrenia
17697119 observed activation of serine racemase by divalent cations has been assumed to be a side-effect associated with ATP binding, which is known to form a complex with Mg(2+) ions
17413456 Observational study of gene-disease association. (HuGE Navigator)
17413456 Not associated with bipolar disorder in a German case-control study.
17413455 Not associated with schizophrenia in a Gefman case-control study.
17067558 Observational study of gene-disease association. (HuGE Navigator)
16837850 Expression of serine racemaseusing Western blot analysis in postmortem hippocampus and cortex in schizophrenia and a comparison group.
16446740 The frequency of the genotypes showed that 5'-G/C serine racemase is not a major risk factor for schizophrenia.
15536068 serine racemase catalyzes the degradation of cellular D-serine itself, through the alpha,beta-elimination of water
15219883 D-serine is synthesized in human placenta by the racemization of L-serine by serine racemase.
15193426 Data report on the isolation of a cDNA encoding a human serine racemase (SRR) from a human neuronal like cell line.

AA Sequence

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD      1 - 70
ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK     71 - 140
RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE    141 - 210
PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL    211 - 280
LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV              281 - 340
//

Text Mined References (43)

PMID Year Title
26913720 2016 MiR-193a-3p and miR-193a-5p suppress the metastasis of human osteosarcoma cells by down-regulating Rab27B and SRR, respectively.
26485193 2016 Loss-of-function mutation of serine racemase attenuates excitotoxicity by intravitreal injection of N-methyl-D-aspartate.
25493718 2015 Understanding the reaction mechanism and intermediate stabilization in mammalian serine racemase using multiscale quantum-classical simulations.
25336657 2014 FBXO22 protein is required for optimal synthesis of the N-methyl-D-aspartate (NMDA) receptor coagonist D-serine.
25331425 2015 Regulation of human serine racemase activity and dynamics by halides, ATP and malonate.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23992455 2013 ATP binding to human serine racemase is cooperative and modulated by glycine.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23112234 2012 Modulating the function of human serine racemase and human serine dehydratase by protein engineering.
22151352 2011 Roles of quaternary structure and cysteine residues in the activity of human serine racemase.
22117694 2012 Paradoxical roles of serine racemase and D-serine in the G93A mSOD1 mouse model of amyotrophic lateral sclerosis.
22096510 2011 Association of six single nucleotide polymorphisms with gestational diabetes mellitus in a Chinese population.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
20385472 2010 Elevated PICK1 mRNA in schizophrenia increased SRR mRNA in suicide.
20174558 2010 A genome-wide association study identifies susceptibility variants for type 2 diabetes in Han Chinese.
20106978 2010 The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19483194 2009 Serine racemase is associated with schizophrenia susceptibility in humans and in a mouse model.
19223009 2009 Association analysis of glycine- and serine-related genes in a Japanese population of patients with schizophrenia.
18812225 2009 Recombinant human serine racemase: enzymologic characterization and comparison with its mouse ortholog.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
17880399 2007 d-Amino acid oxidase and serine racemase in human brain: normal distribution and altered expression in schizophrenia.
17697119 2007 Insights into the activation of brain serine racemase by the multi-PDZ domain glutamate receptor interacting protein, divalent cations and ATP.
17413456 2007 No association between the serine racemase gene (SRR) and bipolar disorder in a German case-control sample.
17413455 2007 No association between the serine racemase gene (SRR) and schizophrenia in a German case-control sample.
17067558 2007 A genetic variant of the serine racemase gene is associated with schizophrenia.
16837850 2006 Serine racemase protein expression in cortex and hippocampus in schizophrenia.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16446740 2006 Polymorphism in the 5'-promoter region of serine racemase gene in schizophrenia.
16314870 2006 Serine racemase binds to PICK1: potential relevance to schizophrenia.
15953485 2005 Identification of multiple serine racemase (SRR) mRNA isoforms and genetic analyses of SRR and DAO in schizophrenia and D-serine levels.
15681805 2004 Induction of serine racemase by inflammatory stimuli is dependent on AP-1.
15536068 2005 Serine racemase modulates intracellular D-serine levels through an alpha,beta-elimination activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15219883 2004 Serine racemase and D-serine transport in human placenta and evidence for a transplacental gradient for D-serine in humans.
15193426 2004 Characterization and localization of a human serine racemase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12560076 2003 Mouse brain serine racemase catalyzes specific elimination of L-serine to pyruvate.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11054547 2000 Human serine racemase: moleular cloning, genomic organization and functional analysis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.