Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.23
PubTator Score 787.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count Z-score Confidence
Retinitis pigmentosa 156 3.576 1.8

Expression

  Differential Expression (40)

Disease log2 FC p
nephrosclerosis 1.394 1.1e-02
malignant mesothelioma -5.800 4.3e-10
astrocytoma 3.200 1.6e-02
oligodendroglioma 2.500 2.4e-02
cutaneous lupus erythematosus 1.300 3.7e-02
psoriasis 1.800 1.6e-03
glioblastoma 3.300 3.5e-03
osteosarcoma 1.917 4.7e-02
ependymoma -1.100 4.8e-02
cystic fibrosis 3.519 2.8e-08
Duchenne muscular dystrophy 2.431 1.7e-10
autosomal dominant Emery-Dreifuss muscul... 1.738 7.3e-04
Becker muscular dystrophy 1.327 2.9e-03
juvenile dermatomyositis 2.290 2.2e-13
limb girdle muscular dystrophy 2A 1.766 3.4e-07
acute quadriplegic myopathy 2.343 1.3e-06
pancreatic ductal adenocarcinoma liver m... -2.352 9.0e-04
non-small cell lung cancer -2.115 5.6e-13
intraductal papillary-mucinous adenoma (... -4.700 4.3e-05
intraductal papillary-mucinous carcinoma... -4.700 8.4e-05
intraductal papillary-mucinous neoplasm ... -4.400 1.7e-03
colon cancer -3.300 2.6e-07
lung cancer -2.000 1.8e-03
active ulcerative colitis 1.169 1.4e-02
breast carcinoma -2.200 2.8e-32
fibroadenoma -2.100 3.6e-04
interstitial cystitis -1.500 3.7e-03
lung adenocarcinoma -1.700 1.4e-13
pediatric high grade glioma 2.200 9.2e-03
group 4 medulloblastoma -2.100 8.7e-03
pilocytic astrocytoma 3.100 1.6e-06
invasive ductal carcinoma -3.200 2.5e-05
non-inflammatory breast cancer -2.100 1.2e-04
COPD 1.400 6.2e-03
lung carcinoma -2.300 6.4e-15
spina bifida -2.580 4.5e-02
ductal carcinoma in situ -1.700 6.2e-03
ovarian cancer 2.700 5.5e-04
pituitary cancer -2.200 2.8e-04
dermatomyositis 1.700 2.2e-02

Gene RIF (8)

PMID Text
20406461 PELO is subcellularly localized at the actin cytoskeleton, interacts with HAX1, EIF3G and SRPX proteins and that this interaction occurs at the cytoskeleton; this interaction may facilitate PELO to detect and degrade aberrant mRNAs.
19862339 This is the first report demonstrating overexpression of ETX1 in glaucomatous trabecular meshwork.
19424611 Downregulation of drs tumor suppressor gene in highly malignant human pulmonary neuroendocrine tumors.
15021917 An apoptosis-inducing protein localized in the endoplasmic reticulum which increases efficiency of apoptosis
12874760 Down-regulation of drs mRNA is closely correlated with development of prostate carcinoma, suggesting a tumor-suppressor function of the drs gene in this cancer.
12716466 down-regulation of drs mRNA is closely correlated with carcinomas which arise from adenomatous polyps in the course of the adenoma-carcinoma sequence, but most carcinomas arising de novo are independent of the tumor suppressor function of the drs gene
12152160 expression of drs mRNA in well-differentiated, moderately differentiated, and poorly differentiated lung adenocarcinoma tissues (drs; down-regulated by v-scr)
209648 The SRPX protein contains the P-DUDES structural domain in its C-terminal region. This domain has significant albeit remote sequence similarity to thioredoxin-like domains, and is predicted to possess an oxidoreductase function.

AA Sequence

MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCR      1 - 70
APQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFN     71 - 140
SRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRD    141 - 210
TADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGD    211 - 280
NYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTA    281 - 350
RNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVD    351 - 420
KHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT                              421 - 464
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20406461 2010 Pelota interacts with HAX1, EIF3G and SRPX and the resulting protein complexes are associated with the actin cytoskeleton.
19862339 2009 ETX1 is over-expressed in the glaucomatous trabecular meshwork.
19424611 2009 Downregulation of drs tumor suppressor gene in highly malignant human pulmonary neuroendocrine tumors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15021917 2004 A novel apoptotic pathway induced by the drs tumor suppressor gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12874760 2003 Down-regulation of drs mRNA in human prostate carcinomas.
12716466 2002 Down-regulation of drs mRNA in colorectal neoplasms.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12152160 2002 Expression of drs mRNA in human lung adenocarcinomas.
9162095 1997 Cloning of a new human gene with short consensus repeats using the EST database.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8634709 1995 Identification of a novel gene, ETX1 from Xp21.1, a candidate gene for X-linked retintis pigmentosa (RP3).
8634708 1995 A gene (SRPX) encoding a sushi-repeat-containing protein is deleted in patients with X-linked retinitis pigmentosa.
209648 [A case of mixed tumor of the palate].