Property Summary

NCBI Gene PubMed Count 72
PubMed Score 68.99
PubTator Score 68.33

Knowledge Summary

Patent (3,171)

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis 1.200 1.6e-03
cutaneous lupus erythematosus 1.100 4.8e-03
osteosarcoma 1.445 3.7e-03
medulloblastoma, large-cell 1.500 7.6e-04
non-small cell lung cancer 1.105 1.7e-17
intraductal papillary-mucinous carcinoma... 1.200 9.4e-03
lung cancer 2.200 8.2e-04
subependymal giant cell astrocytoma -1.335 1.7e-02
lung adenocarcinoma 1.070 1.5e-04
ductal carcinoma in situ 1.100 5.7e-04
invasive ductal carcinoma 1.100 1.9e-02
Breast cancer 1.100 2.7e-07

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (41)

PMID Text
26500332 SRPK1 is upregulated in prostate cancer and correlates with disease stage and invasion.
26244849 Data indicate serine/arginine-rich protein kinases SRPK1/2/SRPIN340 complexes by molecular docking and molecular dynamics.
26099172 SRPK1 mediates TGF-beta-induced proliferation.
26013829 SRPK1 is a regulator of Tra2beta1 splicing function and individual domains engage in considerable cross-talk, assuming novel functions with regard to RNA binding, splicing, and catalysis.
25833691 SRPK1 may be a potential anticancer target to inhibit glioma progression.
25774502 SRPK1 was highly expressed in basal breast cancer. High SRPK1 expression correlated with poor breast cancer disease outcome and preferential metastasis to the lungs and brain.
25529026 Data suggest that proline phosphorylation by CLK1/CDC-like kinase 1 (but not by SRPK1/serine/arginine-rich splicing factor kinase 1) regulates conformation and alternative splicing function of SFRS1 (serine/arginine-rich splicing factor 1).
25381816 Modulation of SRPK1 and subsequent inhibition of tumour angiogenesis.
25187541 ERK1/2 signal induced MNK catalytic activity enabled enterovirus type 1 internal ribosomal entry site-mediated translation/host cell cytotoxicity through negative regulation of the Ser/Arg (SR)-rich protein kinase (SRPK).
25187540 Authors show that MNK regulates SRPK via mTOR and AKT.
25142587 Collectively, these data suggest that human papillomavirus type 1 E1;E4-mediated inhibition of SRPK1 could affect the functions of host serine-arginine proteins and those of the virus transcription/replication regulator E2.
25140042 Up-regulation of SRPK1 is associated with breast cancer.
25010863 Inhibition of SRPK1 by knockdown or with pharmacological inhibitors reduces expression of pro-angiogenic forms of VEGF.
25007957 Hypoxic stress decreased the miR-9 level in ARPE-19 cells, which increased the transcriptional level of SRPK-1, resulting in alternative splicing shift to pro-angiogenic isoforms of VEGF165 in human retinal pigment epithelial cells.
24984036 The data show that the RS domain in SRSF1 is multifunctional and that sequences once thought to be catalytically silent can be recruited to enhance the efficiency of SR protein phosphorylation.
24961466 Increased expression of SRPK1 correlates with the progression of breast cancer.SRPK1 is upregulated in breast cancer at both mRNA and protein levels.
24074032 Data suggest that the conformation of SRPK1 is highly flexible and can readily adapt to changes in structure of arginine-serine rich domains in substrate proteins such as SRSF1 (serine-arginine-rich splicing protein 1).
23707382 The data establish a new view of SRSF1 protein regulation in which SRPK1 and CLK1 partition activities based on Ser-Pro versus Arg-Ser placement rather than on N- and C-terminal preferences along the RS domain.
23644876 SRPK1 plays an oncogenic role in hepatocellular carcinoma through a possible mechanism involving PI3K/Akt.
23405030 positively regulates IFN-lambda1 genes during viral infection
22727668 These findings reveal a major signal transduction pathway for regulated splicing and place SRPKs in a central position in the pathway, consistent with their reputed roles in a large number of human cancers.
22172722 WT1 bound to the SRPK1 promoter, and repressed expression through a specific WT1 binding site
22019390 The present immunohistochemical study reveals a region- and neuron-specific localization of SRPK1 in human brain.
21728354 protein kinase SRPK1 phosphorylates ~10 serines in the arginine--serine-rich domain (RS domain) of the SR protein SRSF1 in a C- to N-terminal direction, a modification that directs this essential splicing factor from the cytoplasm to the nucleus
20708644 SRPK1a may play an important role in linking ribosomal assembly and/or function to erythroid differentiation in human leukaemic cells
20498328 Our results demonstrate that SRPK1 and SRPK2 are host factors essential for Hepatitis C virus replication.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19674106 The enzymatic activity of SR protein kinases 1 and 1a is negatively affected by interaction with scaffold attachment factors B1 and 2.
19553338 These results indicate that ICP27 RGG box methylation regulates interaction ALY and SRPK1 proteins.
19477182 while local RS/SR content steers regional preferences in the RS domain, distal contacts with SRPK1 guide initiation and directional phosphorylation within these regions.
19240134 SRPK1, a ubiquitously expressed SR protein-specific kinase, directly binds to the cochaperones Hsp40/DNAjc8 and Aha1, which mediate dynamic interactions of the kinase with the major molecular chaperones Hsp70 and Hsp90 in mammalian cells
18687337 Data show that adaptable molecular interactions guide phosphorylation of the SR protein ASF/SF2 by SRPK1.
18342604 Data show that a sliding docking interaction is essential for sequential and processive phosphorylation of an SR protein by SRPK1.
18155240 These studies reveal that SRPK1 docks near the C-terminus of the RS1 segment of ASF protein and then moves in an N-terminal direction along the RS domain.
17517895 Sky1p utilizes the same docking groove to bind yeast SR-like protein Gbp2p and phosphorylates all three serines present in a contiguous RS dipeptide stretch
17360743 SRPK1 binding is associated with phosphorylation of human papillomavirus type 1 E1/E4 polypeptide and modulates autophosphorylation of the kinase.
17332336 Serine-arginine protein kinase 1 overexpression is associated with tumorigenic imbalance in mitogen-activated protein kinase pathways.
17223538 We describe crystallographic, molecular dynamics, and biochemical results that shed light on how SRPK1 preserves its constitutive active conformation.
16223727 ASF/SF2 is phosphorylated by SRPK1 and Clk/Sty
16122776 negative role of SRPK1 and SRPK2 in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein
12134018 Both SRPK1 and SRPK2 are most likely the cellular protein kinases mediating HBV core protein phosphorylation during viral infection and therefore represent important host cell targets for therapeutic intervention in HBV infection.

AA Sequence

MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLV      1 - 70
KIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPN     71 - 140
REMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRII    141 - 210
HTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAE    211 - 280
LLEKRMQEIEEMEKESGPGQKRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGG    281 - 350
AAEINCNGVIEVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE    351 - 420
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLVNPLEPKNAEK    421 - 490
LKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEEYT    491 - 560
RDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFL    561 - 630
LPMLELIPEKRATAAECLRHPWLNS                                                 631 - 655
//

Text Mined References (85)

PMID Year Title
26500332 2016 Serine-arginine protein kinase 1 (SRPK1), a determinant of angiogenesis, is upregulated in prostate cancer and correlates with disease stage and invasion.
26244849 2015 Potential Antileukemia Effect and Structural Analyses of SRPK Inhibition by N-(2-(Piperidin-1-yl)-5-(Trifluoromethyl)Phenyl)Isonicotinamide (SRPIN340).
26099172 2015 The crucial role of SRPK1 in TGF-?-induced proliferation and apoptosis in the esophageal squamous cell carcinomas.
26013829 2015 Intra-domain Cross-talk Regulates Serine-arginine Protein Kinase 1-dependent Phosphorylation and Splicing Function of Transformer 2?1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25833691 2015 The influence of SRPK1 on glioma apoptosis, metastasis, and angiogenesis through the PI3K/Akt signaling pathway under normoxia.
25774502 2015 Tumor cell migration screen identifies SRPK1 as breast cancer metastasis determinant.
25529026 2015 Conserved proline-directed phosphorylation regulates SR protein conformation and splicing function.
25381816 2015 Serine-arginine protein kinase 1 (SRPK1) inhibition as a potential novel targeted therapeutic strategy in prostate cancer.
25187541 2014 Induction of viral, 7-methyl-guanosine cap-independent translation and oncolysis by mitogen-activated protein kinase-interacting kinase-mediated effects on the serine/arginine-rich protein kinase.
25187540 2014 Mitogen-activated protein kinase-interacting kinase regulates mTOR/AKT signaling and controls the serine/arginine-rich protein kinase-responsive type 1 internal ribosome entry site-mediated translation and viral oncolysis.
25142587 2014 Human papillomavirus type 1 E1^E4 protein is a potent inhibitor of the serine-arginine (SR) protein kinase SRPK1 and inhibits phosphorylation of host SR proteins and of the viral transcription and replication regulator E2.
25140042 2014 Elevated SRPK1 lessens apoptosis in breast cancer cells through RBM4-regulated splicing events.
25010863 2014 Targeting SRPK1 to control VEGF-mediated tumour angiogenesis in metastatic melanoma.
25007957 2014 MiR-9 regulates the post-transcriptional level of VEGF165a by targeting SRPK-1 in ARPE-19 cells.
24984036 2014 Recruiting a silent partner for activation of the protein kinase SRPK1.
24961466 2014 Serine-arginine protein kinase 1 is associated with breast cancer progression and poor patient survival.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24074032 2013 Splicing kinase SRPK1 conforms to the landscape of its SR protein substrate.
23707382 2013 Partitioning RS domain phosphorylation in an SR protein through the CLK and SRPK protein kinases.
23644876 2013 SRPK1 contributes to malignancy of hepatocellular carcinoma through a possible mechanism involving PI3K/Akt.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23405030 2013 Human kinome analysis reveals novel kinases contributing to virus infection and retinoic-acid inducible gene I-induced type I and type III IFN gene expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22727668 2012 The Akt-SRPK-SR axis constitutes a major pathway in transducing EGF signaling to regulate alternative splicing in the nucleus.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22172722 2011 WT1 mutants reveal SRPK1 to be a downstream angiogenesis target by altering VEGF splicing.
22019390 2012 Distribution of SRPK1 in human brain.
21728354 2011 Applying the brakes to multisite SR protein phosphorylation: substrate-induced effects on the splicing kinase SRPK1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21205204 2011 Phosphorylation mechanism and structure of serine-arginine protein kinases.
21205200 2011 Serine-arginine protein kinases: a small protein kinase family with a large cellular presence.
21157427 2011 Acetylation and phosphorylation of SRSF2 control cell fate decision in response to cisplatin.
21130767 2011 SAFB1 interacts with and suppresses the transcriptional activity of p53.
20708644 2010 The ratio of SRPK1/SRPK1a regulates erythroid differentiation in K562 leukaemic cells.
20498328 2010 Inhibition of hepatitis C virus replication by a specific inhibitor of serine-arginine-rich protein kinase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19886675 2009 Allosteric interactions direct binding and phosphorylation of ASF/SF2 by SRPK1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19674106 2009 The enzymatic activity of SR protein kinases 1 and 1a is negatively affected by interaction with scaffold attachment factors B1 and 2.
19553338 2009 Arginine methylation of the ICP27 RGG box regulates the functional interactions of ICP27 with SRPK1 and Aly/REF during herpes simplex virus 1 infection.
19477182 2009 Regiospecific phosphorylation control of the SR protein ASF/SF2 by SRPK1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19240134 2009 Regulation of SR protein phosphorylation and alternative splicing by modulating kinetic interactions of SRPK1 with molecular chaperones.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18687337 2008 Adaptable molecular interactions guide phosphorylation of the SR protein ASF/SF2 by SRPK1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18342604 2008 A sliding docking interaction is essential for sequential and processive phosphorylation of an SR protein by SRPK1.
18155240 2008 Ordered multi-site phosphorylation of the splicing factor ASF/SF2 by SRPK1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17517895 2007 Structurally unique yeast and mammalian serine-arginine protein kinases catalyze evolutionarily conserved phosphorylation reactions.
17360743 2007 The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17332336 2007 Serine-arginine protein kinase 1 overexpression is associated with tumorigenic imbalance in mitogen-activated protein kinase pathways in breast, colonic, and pancreatic carcinomas.
17223538 2007 SR protein kinase 1 is resilient to inactivation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16223727 2005 Mass spectrometric and kinetic analysis of ASF/SF2 phosphorylation by SRPK1 and Clk/Sty.
16209947 2005 Interplay between SRPK and Clk/Sty kinases in phosphorylation of the splicing factor ASF/SF2 is regulated by a docking motif in ASF/SF2.
16122776 2005 Suppression of hepatitis B virus replication by SRPK1 and SRPK2 via a pathway independent of the phosphorylation of the viral core protein.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15034300 2004 Identification of toposome, a novel multisubunit complex containing topoisomerase IIalpha.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701833 2004 Temporal association of protamine 1 with the inner nuclear membrane protein lamin B receptor during spermiogenesis.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
14555757 2003 Processive phosphorylation of alternative splicing factor/splicing factor 2.
12565829 2003 Protein kinase CK2 phosphorylates and activates the SR protein-specific kinase 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417631 2002 Human autoimmune sera as molecular probes for the identification of an autoantigen kinase signaling pathway.
12134018 2002 Identification of SRPK1 and SRPK2 as the major cellular protein kinases phosphorylating hepatitis B virus core protein.
11509566 2001 Cloning and characterization of an alternatively spliced form of SR protein kinase 1 that interacts specifically with scaffold attachment factor-B.
10390541 1999 SR protein-specific kinase 1 is highly expressed in testis and phosphorylates protamine 1.
10340541 1999 A novel soluble chimera for the treatment of familial hypercholesterolemia.
10198174 1999 Localization of serine kinases, SRPK1 (SFRSK1) and SRPK2 (SFRSK2), specific for the SR family of splicing factors in mouse and human chromosomes.
10196197 1999 The subcellular localization of SF2/ASF is regulated by direct interaction with SR protein kinases (SRPKs).
10049757 1999 SRPK1 and LBR protein kinases show identical substrate specificities.
9472028 1998 SRPK2: a differentially expressed SR protein-specific kinase involved in mediating the interaction and localization of pre-mRNA splicing factors in mammalian cells.
9237760 1997 A protein related to splicing factor U2AF35 that interacts with U2AF65 and SR proteins in splicing of pre-mRNA.
8798720 1996 SRPK1 and Clk/Sty protein kinases show distinct substrate specificities for serine/arginine-rich splicing factors.
8208298 1994 A serine kinase regulates intracellular localization of splicing factors in the cell cycle.