Property Summary

NCBI Gene PubMed Count 26
PubMed Score 23.33
PubTator Score 23.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.6e-03
Multiple myeloma 1.431 1.2e-03
psoriasis 1.200 4.3e-04
osteosarcoma 2.259 5.7e-07
medulloblastoma, large-cell 1.200 3.2e-03
juvenile dermatomyositis 1.338 3.5e-13
acute quadriplegic myopathy 1.314 3.1e-05
lung cancer 1.600 2.5e-04
lung adenocarcinoma 1.008 1.3e-04
ulcerative colitis 1.200 8.1e-06
ovarian cancer 3.100 1.5e-06

 GWAS Trait (1)

Gene RIF (9)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify signal recognition particle 72kDa protein (SRP72), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23048028 SRP68/72 heterodimers as major nuclear proteins whose binding of histone H4 tail is inhibited by H4R3 methylation.
22944692 Tandem affinity purification and mass spectrometry analysis identify signal recognition particle 72kDa protein (SRP72), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22541560 A heterozygous mutation in SRP72 has a role in familial aplasia and myelodysplasia.
21073748 The study delineated the minimal region of SRP72 capable of forming a stable complex with an signal recognition particle RNA fragment.
20729213 Inhibitors of MAPK pathway ERK1/2 or p38 prevent the IL-1{beta}-induced up-regulation of SRP72 autoantigen in Jurkat cells.
18441046 Human signal recognition particle RNA with a single A240G change was unable to form a complex with full-length human SRP72.
16672232 Ninety-four amino acids near the C terminus of SRP68 mediated the binding to SRP72
15588816 Human SRP RNA bound with high affinity to a 63 amino acid residue region near the C terminus of SRP72

AA Sequence

MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINT      1 - 70
HTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQ     71 - 140
DDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACALIGQGQLNQAMKILQKAEDLCRRSL    141 - 210
SEDTDGTEEDPQAELAIIHGQMAYILQLQGRTEEALQLYNQIIKLKPTDVGLLAVIANNIITINKDQNVF    211 - 280
DSKKKVKLTNAEGVEFKLSKKQLQAIEFNKALLAMYTNQAEQCRKISASLQSQSPEHLLPVLIQAAQLCR    281 - 350
EKQHTKAIELLQEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEE    351 - 420
DIDSAIEVFTQAIQWYQNHQPKSPAHLSLIREAANFKLKYGRKKEAISDLQQLWKQNPKDIHTLAQLISA    421 - 490
YSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSAGATYIRKKGGKVTGDSQPKEQGQGDLKKKKKKKKG    491 - 560
KLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGKGTQGATAGASSELDASKTVSSPPTSPRPGS    561 - 630
AATVSASTSNIIPPRHQKPAGAPATKKKQQQKKKKGGKGGW                                 631 - 671
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23048028 2012 A novel histone H4 arginine 3 methylation-sensitive histone H4 binding activity and transcriptional regulatory function for signal recognition particle subunits SRP68 and SRP72.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22541560 2012 Exome sequencing identifies autosomal-dominant SRP72 mutations associated with familial aplasia and myelodysplasia.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21073748 2010 Identification of amino acid residues in protein SRP72 required for binding to a kinked 5e motif of the human signal recognition particle RNA.
20729213 2010 Inhibitors of MAPK pathway ERK1/2 or p38 prevent the IL-1{beta}-induced up-regulation of SRP72 autoantigen in Jurkat cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18441046 2008 The 5e motif of eukaryotic signal recognition particle RNA contains a conserved adenosine for the binding of SRP72.
18089836 2008 A new mechanism of 6-((2-(dimethylamino)ethyl)amino)-3-hydroxy-7H-indeno(2,1-c)quinolin-7-one dihydrochloride (TAS-103) action discovered by target screening with drug-immobilized affinity beads.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17254600 2007 Protein-induced conformational changes of RNA during the assembly of human signal recognition particle.
16672232 2006 Protein SRP68 of human signal recognition particle: identification of the RNA and SRP72 binding domains.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15588816 2005 Identification of an RNA-binding domain in human SRP72.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10964510 2000 Molecular cloning of the critical region for glomerulopathy with fibronectin deposits (GFND) and evaluation of candidate genes.
10618370 2000 Signal recognition particle components in the nucleolus.
9857079 1998 The 72-kDa component of signal recognition particle is cleaved during apoptosis.
9399828 1998 The Signal Recognition Particle Database (SRPDB).
9224693 1997 A truncated isoform of Ca2+/calmodulin-dependent protein kinase II expressed in human islets of Langerhans may result from trans-splicing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8388879 1993 Assembly of the 68- and 72-kD proteins of signal recognition particle with 7S RNA.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2830980 1988 Each of the activities of signal recognition particle (SRP) is contained within a distinct domain: analysis of biochemical mutants of SRP.