Property Summary

NCBI Gene PubMed Count 19
PubMed Score 146.99
PubTator Score 77.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.523 4.7e-03
Multiple myeloma 1.037 1.2e-02
osteosarcoma 1.980 1.2e-05
primary pancreatic ductal adenocarcinoma -1.096 2.3e-02
Alzheimer's disease -1.100 3.6e-02
Pick disease 1.600 1.7e-05
progressive supranuclear palsy -1.100 1.8e-02
ovarian cancer 2.400 1.9e-05
pituitary cancer -1.600 7.6e-05
dermatomyositis 1.700 2.1e-04

Gene RIF (3)

PMID Text
22174317 HIV-1 Rev interacting protein, signal recognition particle 54kDa (SRP54), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12244299 crystal structure of a human SRP ternary complex consisting of SRP19, the M domain of SRP54 and the S domain of 7SL RNA

AA Sequence

MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLN      1 - 70
KRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTF     71 - 140
RAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVAN    141 - 210
AIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHID    211 - 280
DFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILG    281 - 350
MIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL    351 - 420
LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQG    421 - 490
AAGNMKGMMGFNNM                                                            491 - 504
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18089836 2008 A new mechanism of 6-((2-(dimethylamino)ethyl)amino)-3-hydroxy-7H-indeno(2,1-c)quinolin-7-one dihydrochloride (TAS-103) action discovered by target screening with drug-immobilized affinity beads.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14729963 2004 Human RNPS1 and its associated factors: a versatile alternative pre-mRNA splicing regulator in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244299 2002 Induced structural changes of 7SL RNA during the assembly of human signal recognition particle.
11680843 2001 Assembly of the human signal recognition particle (SRP): overlap of regions required for binding of protein SRP54 and assembly control.
10618370 2000 Signal recognition particle components in the nucleolus.
10497032 1999 Crystal structure of the conserved subdomain of human protein SRP54M at 2.1 A resolution: evidence for the mechanism of signal peptide binding.
9512475 1998 Membrane integration of Sec61alpha: a core component of the endoplasmic reticulum translocation complex.
9511762 1998 Protein SRP54 of human signal recognition particle: cloning, expression, and comparative analysis of functional sites.
9016569 1997 Binding site of the M-domain of human protein SRP54 determined by systematic site-directed mutagenesis of signal recognition particle RNA.
8722571 1996 Sequence of the highly conserved gene encoding the human 54kDa subunit of signal recognition particle.
8622769 1996 Regulation by the ribosome of the GTPase of the signal-recognition particle during protein targeting.
8247130 1993 GTP binding and hydrolysis by the signal recognition particle during initiation of protein translocation.