Property Summary

NCBI Gene PubMed Count 20
PubMed Score 140.28
PubTator Score 77.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Alzheimer's disease -1.100 3.6e-02
dermatomyositis 1.700 2.1e-04
Multiple myeloma 1.037 1.2e-02
osteosarcoma 1.323 3.9e-03
ovarian cancer 2.400 1.9e-05
Pick disease 1.600 1.7e-05
pituitary cancer -1.600 7.6e-05
primary pancreatic ductal adenocarcinoma -1.096 2.3e-02
progressive supranuclear palsy -1.100 1.8e-02
Waldenstrons macroglobulinemia 1.523 4.7e-03

Gene RIF (4)

AA Sequence

MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLN      1 - 70
KRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTF     71 - 140
RAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVAN    141 - 210
AIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHID    211 - 280
DFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILG    281 - 350
MIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL    351 - 420
LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQG    421 - 490
AAGNMKGMMGFNNM                                                            491 - 504
//

Text Mined References (27)

PMID Year Title