Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.78
PubTator Score 40.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSR      1 - 70
EWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKG     71 - 140
KKKK                                                                      141 - 144
//

Text Mined References (28)

PMID Year Title