Property Summary

Ligand Count 4
NCBI Gene PubMed Count 13
PubMed Score 38.04
PubTator Score 52.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQ      1 - 70
CTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGM     71 - 140
AIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQ    141 - 210
WLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYN    211 - 280
SDVHRAAFVLPEFARKALNDVS                                                    281 - 302
//

Text Mined References (18)

PMID Year Title