Property Summary

Ligand Count 4
NCBI Gene PubMed Count 13
PubMed Score 38.04
PubTator Score 52.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P19623 B1AKP9 Q15511 SPDSY
Symbols PAPT
SPS1
SPDSY
SRML1

Gene

SRM

PANTHER Protein Class (1)

PDB

2O05   2O06   2O07   2O0L   3RW9  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQ      1 - 70
CTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGM     71 - 140
AIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQ    141 - 210
WLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYN    211 - 280
SDVHRAAFVLPEFARKALNDVS                                                    281 - 302
//

Text Mined References (18)

PMID Year Title