Property Summary

NCBI Gene PubMed Count 61
PubMed Score 468.18
PubTator Score 3804.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.123 3.2e-02
Multiple myeloma 1.684 1.2e-03
astrocytoma 1.100 7.0e-22
glioblastoma multiforme 1.200 9.8e-25
oligodendroglioma 1.200 3.9e-12
osteosarcoma -1.422 2.1e-02
group 4 medulloblastoma -3.000 3.9e-08
atypical teratoid / rhabdoid tumor -1.900 6.0e-04
medulloblastoma, large-cell -3.000 6.2e-07
ulcerative colitis -2.100 6.7e-08
non-small cell lung cancer -1.587 1.8e-17
intraductal papillary-mucinous neoplasm ... 1.100 3.3e-02
colon cancer -2.300 3.8e-05
lung cancer -1.600 8.7e-05
lung adenocarcinoma -1.100 4.7e-08
Breast cancer -1.200 1.4e-05
ovarian cancer 2.300 2.2e-04
chronic rhinosinusitis -1.846 8.2e-03
cystic fibrosis and chronic rhinosinusit... -1.498 1.4e-02

Gene RIF (32)

PMID Text
26719254 The authors verified that NS5A of hepatitis C virus interacted with sorcin through domain I of NS5A, and phosphorylation of the threonine residue 155 of sorcin played a crucial role in protein interaction.
26045737 Drug resistance can be effectively reversed in cisplatin-resistance and adriamycin-resistant myeloma cells through delivery of siRNAs targeting sorcin.
25505242 The interaction of HIV-1 CA with human cellular sorcin (SRI) is identified by yeast two-hybrid screen
25197934 Sorcin is highly expressed in the heart and in the brain, and overexpressed in many cancer cells. [Review]
25001342 Sorcin antibody as a possible predictive factor in conversion from radiologically isolated syndrome to multiple sclerosis: a preliminary study
24796664 overexpression of sorcin increased the phosphorylation of CREB1 and the binding of CREB1 to the CRE sequence of mdr1/p-gp promoter, and induced the expression of MDR1/P-gp
24427308 Sorcin links calcium signaling to vesicle trafficking, regulates Polo-like kinase 1 and is necessary for mitosis.
24376145 Key cellular signaling pathways were triggered by sorcin silencing in the drug resistance of human nasopharyngeal carcinoma.
24337682 sorcin regulates epithelial-mesenchymal transition and cancer stem cells partly through E-cadherin and vascular endothelial growth factor expression.
24013575 down-regulation of sorcin did not alter expression or function of P-gp, but induced cell apoptosis and chemosensitivity in K562/ A02 and MCF-7/A02
22701893 The role of sorcin in multidrug resistance in cancer. [Review]
22338092 sorcin retains ChREBP in the cytosol at low glucose concentrations and may act as a Ca(2+) sensor for glucose-induced nuclear translocation and the activation of ChREBP-dependent genes.
22052463 Data show that colorectal cancer cells overexpress sorcin as an adaptive mechanism to prevent endoplasmic reticulum stress and escape apoptosis triggered by chemotherapeutic agents.
21109982 Overexpression of sorcin by gene transfection was able to confer drug resistance in gastric cancer cells
20858460 The study indicates that stomatin, sorcin, and synexin are echinophilic membrane components that mainly locate outside GM1 rafts in the human erythrocyte membrane.
20647321 Depletion of TRAP1 by short hairpin RNA in colorectal carcinoma cells lowered Sorcin levels in mitochondria, whereas the depletion of Sorcin by small interfering RNA increased TRAP1 degradation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20012234 Overexpression of sorcin was associated with gemcitabine resistance in non-small cell lung cancer.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19885748 Upregulation of sorcin is associated with gastric cancer.
18423116 Overexpression of sorcin could induce low level of multidrug resistant (MDR) in SGC7901 cells, indicating that sorcin is associated with MDR of SGC7901 cells.
18315902 Tetrandrine reverses multidrug-resistance of K562/A02 cells through regulation of expression of SORCIN.
17699613 provide a plausible structural and functional framework that helps elucidate the phenotypic alterations of mice overexpressing F112L-sorcin
17541155 Knock-down of SRI induces up-regulation of MDR1 in HeLa cells.
16934756 sorcin plays an important role in the emergence of MDR in leukemia cells via regulating cell apoptosis pathways
16931553 Sorcin interacts with and modulates ryanodine receptor activity in rat vascular smooth muscle cells.
16320026 Semi-quantitative RT-PCR experiments with 6 of those genes confirmed higher expression of DNCH2, ARHGEF6, NPM1 and SRI and lower expression of NRGN and TM4SF2 in GBM tumors.
15808837 Overexpression of SOR improves cardiac contractility independent of beta-adrenergic stimulation.
12804766 SRI interacts with GCA in vivo and in vitro.
12754254 data indicate that sorcin modulates intracellular calcium cycling and calcium influx pathways in the heart
12411058 Sorcin gene overexpression is significantly associated with clinical multidrug resistance and prognosis, it is one of the indicators for predicting prognosis of acute myeloid leukemia patients
12408767 relationship between soluble resistance-related calcium-binding protein (sorcin) gene and multidrug resistance gene (mdr1), and their significance in clinical drug resistance and prognosis of acute myeloid leukemia (AML)

AA Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPF      1 - 70
NLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQA     71 - 140
VNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV                141 - 198
//

Text Mined References (66)

PMID Year Title
26719254 2015 Nonstructural 5A Protein of Hepatitis C Virus Regulates Soluble Resistance-Related Calcium-Binding Protein Activity for Viral Propagation.
26045737 2015 shRNA-mediated silencing of sorcin increases drug chemosensitivity in myeloma KM3/DDP and U266/ADM cell lines.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25197934 2014 Sorcin, a calcium binding protein involved in the multidrug resistance mechanisms in cancer cells.
25001342 2014 Sorcin antibody as a possible predictive factor in conversion from radiologically isolated syndrome to multiple sclerosis: a preliminary study.
24796664 2014 Increased expression of sorcin is associated with multidrug resistance in leukemia cells via up-regulation of MDR1 expression through cAMP response element-binding protein.
24427308 2014 Sorcin links calcium signaling to vesicle trafficking, regulates Polo-like kinase 1 and is necessary for mitosis.
24376145 2014 Reversing effect of sorcin in the drug resistance of human nasopharyngeal carcinoma.
24337682 2014 Sorcin silencing inhibits epithelial-to-mesenchymal transition and suppresses breast cancer metastasis in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24013575 2013 Inhibition of sorcin reverses multidrug resistance of K562/A02 cells and MCF-7/A02 cells via regulating apoptosis-related proteins.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22701893 2012 Sorcin, a potential therapeutic target for reversing multidrug resistance in cancer.
22338092 2012 Glucose-induced nuclear shuttling of ChREBP is mediated by sorcin and Ca(2+) ions in pancreatic ?-cells.
22052463 2011 Sorcin induces a drug-resistant phenotype in human colorectal cancer by modulating Ca(2+) homeostasis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
21109982 2011 Overexpression of sorcin results in multidrug resistance in gastric cancer cells with up-regulation of P-gp.
20858460 2010 Echinophilic proteins stomatin, sorcin, and synexin locate outside gangliosideM1 (GM1) patches in the erythrocyte membrane.
20647321 2010 Mitochondrial chaperone Trap1 and the calcium binding protein Sorcin interact and protect cells against apoptosis induced by antiblastic agents.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20012234 2010 Comparative proteomic profiling identified sorcin being associated with gemcitabine resistance in non-small cell lung cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19885748 2010 Upregulation of soluble resistance-related calcium-binding protein (sorcin) in gastric cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18423116 2008 [Correlation of sorcin overexpression to multidrug resistance of human gastric cancer cell line SGC7901].
18315902 2008 [Influence of tetrandrine on SORCIN gene expression in K562/A02 cell line].
17699613 2008 Molecular basis for the impaired function of the natural F112L sorcin mutant: X-ray crystal structure, calcium affinity, and interaction with annexin VII and the ryanodine receptor.
17541155 2007 Knock-down of sorcin induces up-regulation of MDR1 in HeLa cells.
17215369 2007 Molecular markers of early Parkinson's disease based on gene expression in blood.
17130302 2007 Expression of a sorcin missense mutation in the heart modulates excitation-contraction coupling.
16934756 2006 Overexpression of sorcin in multidrug resistant human leukemia cells and its role in regulating cell apoptosis.
16931553 2006 Sorcin modulation of Ca2+ sparks in rat vascular smooth muscle cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16320026 2006 Identification of histological markers for malignant glioma by genome-wide expression analysis: dynein, alpha-PIX and sorcin.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15808837 2005 Overexpression of sorcin enhances cardiac contractility in vivo and in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15326289 2004 Identification and proteomic profiling of exosomes in human urine.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12804766 2003 The PEF family proteins sorcin and grancalcin interact in vivo and in vitro.
12754254 2003 Sorcin regulates excitation-contraction coupling in the heart.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411058 2002 Expression and clinical implications of the soluble drug resistance-related calcium-binding protein (sorcin) gene in leukemia patients.
12408767 2002 Expression and clinical implication of soluble resistance-associated calcium-binding protein gene and multi-drug resistance gene in leukemia.
11714909 2001 Crystal structure of calcium-free human sorcin: a member of the penta-EF-hand protein family.
10748169 2000 Presenilin 2 interacts with sorcin, a modulator of the ryanodine receptor.
10672515 1999 Expression and localisation of annexin VII (synexin) isoforms in differentiating myoblasts.
9668070 1998 Sorcin associates with the pore-forming subunit of voltage-dependent L-type Ca2+ channels.
9570944 1998 Localization of 67 exons on a YAC contig spanning 1.5 Mb around the multidrug resistance gene region of human chromosome 7q21.1.
9268363 1997 Calcium-dependent binding of sorcin to the N-terminal domain of synexin (annexin VII).
8561500 1996 Purification, cDNA cloning, and expression of human sorcin in vincristine-resistant HOB1 lymphoma cell lines.
7873602 1995 Isolation and molecular cloning of human sorcin a calcium-binding protein in vincristine-resistant HOB1 lymphoma cells.
7835417 1995 Calcium-dependent translocation of sorcin to membranes: functional relevance in contractile tissue.
7592856 1995 Association of sorcin with the cardiac ryanodine receptor.
2901906 1988 Genes amplified and overexpressed in human multidrug-resistant cell lines.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.