Property Summary

NCBI Gene PubMed Count 48
PubMed Score 526.65
PubTator Score 281.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
IGA Glomerulonephritis 454

Expression

  Differential Expression (36)

Disease log2 FC p
nephrosclerosis 1.313 1.7e-04
Waldenstrons macroglobulinemia 2.416 6.4e-03
Multiple myeloma 1.515 5.8e-03
malignant mesothelioma -8.300 2.5e-09
esophageal adenocarcinoma 2.000 2.4e-02
psoriasis 1.600 6.3e-04
cutaneous lupus erythematosus 2.800 2.6e-03
glioblastoma 2.700 1.4e-03
group 4 medulloblastoma -1.900 7.1e-04
periodontitis 1.400 4.8e-22
medulloblastoma, large-cell -2.400 6.0e-06
Duchenne muscular dystrophy 1.673 9.9e-06
limb girdle muscular dystrophy 2I 1.007 1.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.464 1.8e-02
juvenile dermatomyositis 2.205 2.7e-11
pancreatic ductal adenocarcinoma liver m... -2.438 1.4e-03
non-small cell lung cancer -1.301 3.7e-12
intraductal papillary-mucinous adenoma (... -2.500 6.8e-03
intraductal papillary-mucinous carcinoma... -3.700 4.3e-04
intraductal papillary-mucinous neoplasm ... -2.900 1.8e-02
Hydrolethalus syndrome 4.664 6.2e-03
lung cancer -3.700 2.1e-06
breast carcinoma 1.200 4.3e-02
interstitial cystitis 2.300 1.8e-05
cystic fibrosis 4.100 7.9e-06
atypical teratoid/rhabdoid tumor -1.100 9.0e-03
primary Sjogren syndrome 2.300 8.6e-05
lung adenocarcinoma -1.900 3.8e-07
invasive ductal carcinoma 1.200 8.0e-03
lung carcinoma -2.600 2.7e-29
ulcerative colitis 4.200 8.1e-08
ovarian cancer -3.100 4.1e-08
pituitary cancer -1.800 1.9e-04
Down syndrome 2.100 1.1e-03
pancreatic cancer 1.800 4.6e-04
dermatomyositis 2.200 8.7e-04

Gene RIF (19)

PMID Text
26694746 These results suggest functions for serglycin in endothelial cells trough interactions with partner molecules, in biological processes with relevance for diabetic complications, cardiovascular disease and cancer development.
26581653 The elevated levels of serglycin in aggressive cancer and stromal cells may suggest a key role for serglycin in disease progression
24513305 These results suggest that different signaling pathways are involved in regulating secretion of serglycin and partner molecules in activated endothelial cells.
24403068 These studies provide direct evidence for a critical role for serglycin in MM pathogenesis and show that targeting serglycin may provide a novel therapeutic approach for MM.
23996242 The reduced expression of SRGN was accompanied by elevated levels of E-cadherin.
23387827 Cell-surface SRGN promotes the adhesion of myeloma cells to collagen type I.
23376071 These results suggest that human epicardial adipose tissue (EAT) has strong inflammatory properties in patients with coronary artery disease and provide novel evidence that serglycin is an adipocytokine highly expressed in EAT.
22807344 This review covers recent studies on the involvement of serglycin in various pathological conditions, as well as its roles in immunity, hemostasis, cell growth, apoptosis, and reproduction.
21849484 Human granulocyte precursors transfected with siRNA against serglycin displayed reduced capability to retain fully processed HNP-1.
21289131 Serglycin regulates NPC metastasis via autocrine and paracrine routes, and that it serves as an independent prognostic indicator of metastasis-free survival and disease-free survival in NPC patients.
21268013 Serglycin secreted by human multiple myeloma cell lines inhibits both the classical and lectin pathways of complement, without influencing alternative pathway activity.
21075844 Serglycin is a major proteoglycan in polarized human endothelial cells and is implicated in the secretion of the chemokine GROalpha/CXCL1.
18000860 Mutations in SRGN is not associated with familial hemophagocytic lymphohistiocytosis
17909965 Serglycin is of importance for secretory processes in human monocytes.
16870619 Serglycin release is a constitutive process, which may be of fundamental biological importance in the study of multiple myeloma.
15788411 mechanism of delivery is proposed entailing electrostatic transfer of granzyme B from serglycin to cell surface proteins
14739229 serglycin-bound granzyme B in high-molecular-weight degranulate material from cytotoxic T lymphocytes predominantly followed a dynamin-dependent pathway to kill target cells
14506241 cell- and differentiation-specific alterations in chromatin structure may control serglycin gene expression
12388539 proapoptotic granzyme is exocytosed predominantly as a macromolecular complex with serglycin

AA Sequence

MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRL      1 - 70
RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNL     71 - 140
PSDSQDLGQHGLEEDFML                                                        141 - 158
//

Text Mined References (51)

PMID Year Title
26694746 2015 Serglycin in Quiescent and Proliferating Primary Endothelial Cells.
26581653 2015 Increased Expression of Serglycin in Specific Carcinomas and Aggressive Cancer Cell Lines.
25416956 2014 A proteome-scale map of the human interactome network.
24513305 2014 Serglycin secretion is part of the inflammatory response in activated primary human endothelial cells in vitro.
24403068 2014 Serglycin proteoglycan is required for multiple myeloma cell adhesion, in vivo growth, and vascularization.
23996242 2013 Serglycin (SRGN) overexpression predicts poor prognosis in hepatocellular carcinoma patients.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23387827 2013 Cell-surface serglycin promotes adhesion of myeloma cells to collagen type I and affects the expression of matrix metalloproteinases.
23376071 2013 Serglycin is a novel adipocytokine highly expressed in epicardial adipose tissue.
22807344 2012 Serglycin in health and diseases.
21849484 2011 Serglycin participates in retention of ?-defensin in granules during myelopoiesis.
21289131 2011 Serglycin is a theranostic target in nasopharyngeal carcinoma that promotes metastasis.
21268013 2011 Serglycin inhibits the classical and lectin pathways of complement via its glycosaminoglycan chains: implications for multiple myeloma.
21075844 2011 Serglycin is a major proteoglycan in polarized human endothelial cells and is implicated in the secretion of the chemokine GROalpha/CXCL1.
18000860 2008 Sequence analysis of the SRGN, AP3B1, ARF6, and SH2D1A genes in familial hemophagocytic lymphohistiocytosis.
17909965 2008 Serglycin and secretion in human monocytes.
16870619 2006 Serglycin constitutively secreted by myeloma plasma cells is a potent inhibitor of bone mineralization in vitro.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16420477 2006 Secretion of proteases in serglycin transfected Madin-Darby canine kidney cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15788411 2005 A novel mechanism for protein delivery: granzyme B undergoes electrostatic exchange from serglycin to target cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15136585 2004 Localization of serglycin in human neutrophil granulocytes and their precursors.
14739229 2004 The granzyme B-serglycin complex from cytotoxic granules requires dynamin for endocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14506241 2003 DNase I hypersensitivity patterns of the serglycin proteoglycan gene in resting and phorbol 12-myristate 13-acetate-stimulated human erythroleukemia (HEL), CHRF 288-11, and HL-60 cells compared with neutrophils and human umbilical vein endothelial cells.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388539 2002 Cytotoxic cell granule-mediated apoptosis. Characterization of the macromolecular complex of granzyme B with serglycin.
11911826 2002 Cytotoxic cell granule-mediated apoptosis: perforin delivers granzyme B-serglycin complexes into target cells without plasma membrane pore formation.
11469527 2001 Serglycin expression in CD2+ and CD14+ cells from patients with various rheumatic diseases.
11154222 2001 Synthesis, secretion, and subcellular localization of serglycin proteoglycan in human endothelial cells.
11012225 1996 Regulation of expression of megakaryocyte and platelet proteoglycans.
10228010 1999 Apoptosis induced by granzyme B-glycosaminoglycan complexes: implications for granule-mediated apoptosis in vivo.
9334256 1997 Widespread expression of chondroitin sulfate-type serglycins with CD44 binding ability in hematopoietic cells.
8613703 1996 Serglycin-binding proteins in activated macrophages and platelets.
7821789 1994 Construction of a human full-length cDNA bank.
7559813 1995 Serglycin and betaglycan proteoglycans are expressed in the megakaryocytic cell line CHRF 288-11 and normal human megakaryocytes.
4062880 1985 Masticatory lubrication. The role of carbohydrate in the lubricating property of a salivary glycoprotein-albumin complex.
3402609 1988 Complete amino acid sequence of a human platelet proteoglycan.
3366780 1988 Isolation of a cDNA that encodes the peptide core of the secretory granule proteoglycan of rat basophilic leukemia-1 cells and assessment of its homology to the human analogue.
3214420 1988 Characterization and N-terminal sequence of human platelet proteoglycan.
2835370 1988 Isolation and characterization of a cDNA that encodes the peptide core of the secretory granule proteoglycan of human promyelocytic leukemia HL-60 cells.
2798108 1989 Nucleotide sequence of a cDNA encoding a hemopoietic proteoglycan core protein.
2726751 1989 Molecular cloning of a cDNA that encodes the peptide core of a mouse mast cell secretory granule proteoglycan and comparison with the analogous rat and human cDNA.
2714783 1989 Localization of human platelet proteoglycan gene to chromosome 10, band q22.1, by in situ hybridization.
2180935 1990 Characterization of the human gene that encodes the peptide core of secretory granule proteoglycans in promyelocytic leukemia HL-60 cells and analysis of the translated product.
1377686 1992 The human serglycin gene. Nucleotide sequence and methylation pattern in human promyelocytic leukemia HL-60 cells and T-lymphoblast Molt-4 cells.