Property Summary

NCBI Gene PubMed Count 7
PubMed Score 21.35
PubTator Score 0.75

Knowledge Summary


No data available


  Disease (1)



Accession P0DJJ0
Symbols SRGAP2P1


PANTHER Protein Class (2)

 GO Component (1)

AA Sequence

SVKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF                                   421 - 459

Text Mined References (9)

PMID Year Title
27373832 2016 SRGAP2 and Its Human-Specific Paralog Co-Regulate the Development of Excitatory and Inhibitory Synapses.
26206078 2015 All-or-(N)One - an epistemological characterization of the human tumorigenic neuronal paralogous FAM72 gene loci.
22559944 2012 Inhibition of SRGAP2 function by its human-specific paralogs induces neoteny during spine maturation.
22559943 2012 Evolution of human-specific neural SRGAP2 genes by incomplete segmental duplication.
17903296 2007 Genome-wide association with bone mass and geometry in the Framingham Heart Study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.