Property Summary

NCBI Gene PubMed Count 3
PubMed Score 21.35
PubTator Score 0.75

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.6e-17


  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.500 1.6e-17


Accession P0DMP2
Symbols SRGAP2L


AA Sequence

VKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF                                    421 - 458

Text Mined References (4)

PMID Year Title
22559944 2012 Inhibition of SRGAP2 function by its human-specific paralogs induces neoteny during spine maturation.
22559943 2012 Evolution of human-specific neural SRGAP2 genes by incomplete segmental duplication.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.