Property Summary

NCBI Gene PubMed Count 26
PubMed Score 21.35
PubTator Score 25.36

Knowledge Summary

Patent

No data available

Gene RIF (11)

PMID Text
23892896 interlocus gene conversions in SRGAP2
23782070 This study illustrated that the role of SRGAP2 protein and its human-specific paralogs in human brain development and evolution.
22559944 Results uncover a new function for ancestral SRGAP2 in promoting dendritic spine maturation and indicate that expression of a human-specific paralog of SRGAP2 in mouse pyramidal neurons extends the phase of spine development and leads to an increased density of longer spines in vivo, a feature characterizing pyramidal neurons in the human neocortex
22559943 SRGAP2 has been highly conserved over mammalian evolution, and human is the only lineage wherein gene duplications have occurred. Our analysis indicates that the duplications spread across 80 Mbp of chromosome 1 at a time corresponding to the transition from Australopithecus to Homo.
21148482 after Rac-dependent activation of FMNL1, srGAP2 mediates a potent mechanism to limit the duration of Rac action and inhibit formin activity during rapid actin dynamics.
20810653 srGAP2 arginine methylation plays important roles in cell spreading and cell migration through influencing membrane protrusion.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602751 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12736724 FNBP2 gene was linked to IKBKE and NORE1 genes on human chromosome 1q32.1. FNBP2 mRNA was expressed in melanoma, germ cell tumors, chondrosarcoma and retinoblastoma.

AA Sequence

MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKL      1 - 70
AERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFK     71 - 140
KSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDST    141 - 210
ANVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCC    211 - 280
DLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMG    281 - 350
DMASQLCAQQPVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME    351 - 420
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGESQRTDCSLAR    421 - 490
RSSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDS    491 - 560
IAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALHIRKVLLVLPKTTLIIMRYLFAFLNHLSQFS    561 - 630
EENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTIIIQHENIFPSPRELEGPVYSRGGSMEDYC    631 - 700
DSPHGETTPVEDSTQDVTAEHHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRH    701 - 770
NGIDGLIPHQYIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKR    771 - 840
PESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGSLNSISRHSSL    841 - 910
KNRLDSPQIRKTATAGRSKSFNNHRPMDPEVIAQDIEATMNSALNELRELERQSSVKHTPDVVLDTLEPL    911 - 980
KTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPATRPKPTVFPKTN    981 - 1050
ATSPGVNSSTSPQSTDKSCTV                                                    1051 - 1071
//

Text Mined References (33)

PMID Year Title
23892896 2013 Rapid and accurate large-scale genotyping of duplicated genes and discovery of interlocus gene conversions.
23782070 2013 The role of human-specific gene duplications during brain development and evolution.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23031429 2012 A genome-wide association study of monozygotic twin-pairs suggests a locus related to variability of serum high-density lipoprotein cholesterol.
22559944 2012 Inhibition of SRGAP2 function by its human-specific paralogs induces neoteny during spine maturation.
22559943 2012 Evolution of human-specific neural SRGAP2 genes by incomplete segmental duplication.
22467852 2012 The F-BAR domains from srGAP1, srGAP2 and srGAP3 regulate membrane deformation differently.
22106086 2012 Early infantile epileptic encephalopathy associated with the disrupted gene encoding Slit-Robo Rho GTPase activating protein 2 (SRGAP2).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21148482 2011 Bi-modal regulation of a formin by srGAP2.
20810653 2010 srGAP2 arginine methylation regulates cell migration and cell spreading through promoting dimerization.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16318909 2006 Regulation of FasL expression: a SH3 domain containing protein family involved in the lysosomal association of FasL.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15046868 2004 Changes in mRNA of Slit-Robo GTPase-activating protein 2 following facial nerve transection.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12736724 2003 FNBP2 gene on human chromosome 1q32.1 encodes ARHGAP family protein with FCH, FBH, RhoGAP and SH3 domains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11672528 2001 Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.
8268792 1993 Determination of 5' ends of specific mRNAs by DNA ligase-dependent amplification.