Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.77
PubTator Score 7.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.267 8.8e-04
astrocytoma 1.300 4.0e-02
ependymoma 1.800 2.0e-02
glioblastoma -1.800 4.1e-05
osteosarcoma -1.551 8.6e-04
atypical teratoid / rhabdoid tumor -1.600 3.9e-04
medulloblastoma, large-cell -1.300 3.9e-04
primitive neuroectodermal tumor 1.100 7.2e-03
acute quadriplegic myopathy 1.229 2.2e-05
adrenocortical carcinoma 1.115 8.4e-03
tuberculosis and treatment for 6 months 1.900 5.5e-05
intraductal papillary-mucinous adenoma (... 1.200 3.6e-03
intraductal papillary-mucinous carcinoma... 1.200 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-02
adult high grade glioma 1.400 1.4e-02
psoriasis 1.200 3.0e-07
Pick disease -1.300 3.9e-04
progressive supranuclear palsy -1.100 2.5e-02
Breast cancer -1.900 4.5e-15
ovarian cancer -2.300 1.5e-08
head and neck cancer -1.100 6.3e-04

Gene RIF (4)

PMID Text
20400856 From among the 500 splicing events exhibiting altered splicing under these conditions, the splicing of c-Jun and IkappaBbeta were validated as being regulated by SRrp86 resulting in altered regulation of their downstream targets.
15456940 p18SRP is a lysine-rich zinc finger domain-containing protein that interacts with the serine-arginine-rich splicing regulatory protein SRrp86; it is downregulated in brain of Alzheimer disease patients.
12183448 the unique glutamic acid-lysine domain of SRrp86 plays a modulatory role controlling serine-arginine domain function
11991645 SRrp86 can activate SRp20 and repress SC35 in a dose-dependent manner both in vitro and in vivo

AA Sequence

MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYV      1 - 70
GNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHS     71 - 140
NNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRR    141 - 210
KRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDRE    211 - 280
KEREREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKE    281 - 350
IDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKRE    351 - 420
KERDHISERRERERSTSMRKSSNDRDGKEKLEKNSTSLKEKEHNKEPDSSVSKEVDDKDAPRTEENKIQH    421 - 490
NGNCQLNEENLSTKTEAV                                                        491 - 508
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20400856 Analysis of SRrp86-regulated alternative splicing: control of c-Jun and I?B? activity.
19951526 2009 [Changes of gene expression profile in homoharringtonine-induced leukemia multi-drug resistant cell line K562/HHT].
19309015 2009 2-D PAGE-based comparison of proteasome inhibitor bortezomib in sensitive and resistant mantle cell lymphoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456940 2004 The splicing regulatory protein p18SRP is down-regulated in Alzheimer's disease brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403470 2002 PSF and p54nrb bind a conserved stem in U5 snRNA.
12183448 2002 A unique glutamic acid-lysine (EK) domain acts as a splicing inhibitor.
12176931 2002 Large-scale proteomic analysis of the human spliceosome.
12043562 2002 [Molecular cloning, characterization, chromosomal assignment, genomic organization and verification of SFRS12(SRrp508), a novel member of human SR protein superfamily and a human homolog of rat SRrp86].
11991645 2002 Regulation of alternative splicing by SRrp86 through coactivation and repression of specific SR proteins.
10757789 2000 Identification and characterization of a novel serine-arginine-rich splicing regulatory protein.