Property Summary

Ligand Count 347
NCBI Gene PubMed Count 226
PubMed Score 0.00
PubTator Score 303.05

Knowledge Summary

Patent

No data available

Gene RIF (234)

AA Sequence

MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILAR      1 - 70
QPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGW     71 - 140
YTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWS    141 - 210
LPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF                              211 - 254
//

Text Mined References (230)

PMID Year Title