Property Summary

NCBI Gene PubMed Count 87
PubMed Score 82.05
PubTator Score 1570.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma -3.300 1.6e-03
ependymoma -3.500 3.2e-03
oligodendroglioma -3.000 4.2e-03
esophageal adenocarcinoma -1.400 4.0e-02
glioblastoma -2.800 1.6e-08
atypical teratoid / rhabdoid tumor -2.800 3.9e-06
medulloblastoma, large-cell -1.200 4.5e-03
adrenocortical carcinoma 1.763 2.8e-04
tuberculosis 2.000 9.0e-09
non-small cell lung cancer 2.731 8.7e-25
intraductal papillary-mucinous adenoma (... 1.400 9.7e-03
intraductal papillary-mucinous carcinoma... 1.200 1.8e-02
intraductal papillary-mucinous neoplasm ... 2.500 2.9e-03
lung cancer 2.000 6.0e-05
colon cancer 1.300 3.5e-02
Parkinson's disease -1.200 4.6e-02
pancreatic cancer 1.100 2.5e-04
adult high grade glioma -3.100 6.0e-05
pilocytic astrocytoma -3.800 4.4e-11
lung adenocarcinoma 1.896 3.9e-07
lung carcinoma 1.400 2.0e-24
Pick disease -1.500 1.9e-03
ductal carcinoma in situ 2.300 7.8e-04
invasive ductal carcinoma 2.800 7.0e-03
ovarian cancer 2.100 5.3e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (70)

PMID Text
26174685 the genotypic distribution of 22 single nucleotide polymorphisms in SRD5A1 and SRD5A2 in a set of Spanish prostate cancer patients, were evaluated.
25960412 A total of 2 SNPs in SRD5A1-rs3822430 and rs1691053-were associated with prostate-specific antigen level at diagnosis.
25850410 study found SRD5A enzyme is present in spermatozoa and that its cellular content is lowered in sperm samples from varicocele patients compared to healthy subjects
25475427 Results show that 5alpha-reductase type 1 was associated with intratumoral dihydrotestosterone concentrations and is an independent prognostic factor in endometrioid endometrial adenocarcinoma.
25463305 In model cell lines of endometrial cancer, AKR1C2 and SRD5A1 have crucial roles in progesterone metabolism.
24986533 Increased 5alphaR activity and glucocorticoid secretion rate over time are linked with the development of metabolic disease, and may represent targets for therapeutic intervention.
24277450 SRD5A1 rs166050C risk variant was associated with greater prostatic exposure to androsterone
24244276 Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue
23499746 SRD5A1 and SRD5A2 single nucleotide polymorphisms are significantly associated with the clinical characteristics of benign prostatic hyperplasia and the efficacy of benign prostatic hyperplasia treatment.
23183084 Different effects were seen for progesterone, which significantly decreased SRD5A1 protein levels.
22509838 Based on a limited selection of gene variants, no involvement of SRD5A1, SRD5A2, ESR1, ESR2 or PGR in female pattern hair loss is evident.
22273344 Ten percent of cases and 44% of controls had the cytosine/cytosine (C/C) genotype for the SRD5A1 SNP, rs501999 indicating that this genotype may protect women against severe premenstrual symptoms.
22194926 The different expression levels of 5alpha-reductase isoenzymes may confer response or resistance to 5alpha-reductase inhibitors.
21947678 Postmenopausal breast cancer risk associated with combined therapy may be modified by genetic variation in SRD5A1
21795608 the dominant route of Dihydrotestosterone synthesis in castration-resistant prostate cancer bypasses testosterone, and instead requires 5alpha-reduction of androstenedione by SRD5A1 to 5alpha-androstanedione, which is then converted to DHT
21715084 Show positive associations of several SRD5A1 and SRD5A2 variations as independent predictors of biochemical recurrence after radical prostatectomy.
21676395 A statistically significant reduction of SRD5A1, SRD5A2, and CYP19A gene expression was found in the dermal papillae cells and peripheral blood mononuclear cells in idiopathic hirsutism.
21530059 Single nucleotide polymorphisms in the two isoforms of 5alpha-reductase, SRD5A1 and SRD5A2, are associated with lean patients with polycystic ovary syndrome.
21447938 Pitfalls in the diagnosis of 5alpha-reductase type 2 deficiency during early infancy.
21323680 Evidence of association of two alleles for alcohol dependence (AD) is found in SRD5A1 and AKR1C3, mediating a protective effect of the minor allele at each AD marker based on the genotype of the second marker.
20800085 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20672519 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20519274 High nuclear SRD5A1 expression is associated with higher prostate cancer stage.
20214802 Observational study of gene-disease association. (HuGE Navigator)
20200332 Observational study of gene-disease association. (HuGE Navigator)
20086173 Data indicate that enzymes CYP17A1 and HSD3B1 showed low expression, while AKR1C3 and SRD5A1 were abundantly expressed.
20056642 We investigated associations between single nucleotide polymorphisms in genes HSD3B1, SRD5A1/2, and AKR1C2 and prostate cancer risk
20056642 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19886072 hyperandrogenemia is associated with high levels of expression of 5-alpha reductase type 1 and, to a less extent, of type 2 isoenzyme in pubian skin cultured fibroblasts
19846565 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19574343 Observational study of gene-disease association. (HuGE Navigator)
19383266 Report changes in human placental 5alpha-reductase isoenzyme expression with advancing gestation: effects of fetal sex and glucocorticoid exposure.
19246976 A decreased local enzymatic conversion of testosterone may contribute to PAD genetic susceptibility.
19246976 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18633104 Enhanced 5alphaR activity in both sexes is associated with insulin resistance but not body composition
18483391 the SRD5A2 V89L VV genotype interacts with VDR FokI TT/CT genotypes in non-Hispanic White men and VDR CDX2 GG genotypes in Hispanic White men to increase the risk for prostate cancer.
18422030 Testosterone 5-alpha-Reductase deficiency is associated with gender identity
18258185 Our results demonstrate that the 5alphaR activities of either bDPCs or sDPCs are stronger than that of dermal fibroblasts, despite the fact that the major steroidogenic activity is attributed to 17beta-HSD rather than 5alphaR among the three cell types.
18215136 Hepatocyte growth factor stimulates 5alpha-R1 expression through up-regulation of the transcription factor early growth response 1
18008328 Both 5-alpha-reductase I and II are expressed in normal human prostate stromal and epithelial cells. Only 5-alpha-reductase isoenzymes of prostate epithelium are modulated by oxytocin.
17218734 Observational study of gene-disease association. (HuGE Navigator)
17066438 These results suggest that intratumoral 5 alpha-dihydrotestosterone concentration is mainly determined by 5alphaRed1 and aromatase in breast carcinoma tissues.
16849416 Observational study of gene-disease association. (HuGE Navigator)
16818707 The SRD5A1 mRNA expression is 2-fold lower than SRD5A2 in normal rat.
16155734 Observational study of gene-disease association. (HuGE Navigator)
16100771 Observational study of gene-disease association. (HuGE Navigator)
15941927 SRD5A1 is abundantly transcribed in normal human genital skin fibroblasts and may play an important role in masculinization of SRD5A2-deficient males.
15862960 The expression of 5alpha-reductase type I mRNA was not regulated by calcitriol in a prostate tumor cell line.
15792368 5alpha-reductase is expresed in human embryonic kidney cell line HEK293
15543614 Serenoa repens inhibits this enzyme in the prostate, but does not suppress prostate-specific antigen secretion in prostate cancer.
15538746 5alpha-reductase type 1 (5alphaR1) immunostaining is increased and 5alpha-reductase type 2(5alphaR2) immunostaining is decreased during development of prostate cancer and there is increased expression of both in recurrent and metastatic cancers
15212687 Expression of SRD5A1 (5alphaR1) and SRD5A2 (5alphaR2) is elevated, and expression of AKR1C1 (20alpha-HSO), AKR1C2 (3alpha-HSO3) and AKR1C3 (3alpha-HSO2) is reduced in tumorous as compared to normal breast tissue.
15136785 Observational study of gene-disease association. (HuGE Navigator)
15136785 Candidate gene for benign prostatic hyperplasia.
15004407 Glucocorticoids and androgens differentially regulate 5alphaR1 mRNA in the rat liver. Regulation of 5alphaR1 gene is primarily at the post-transcriptional level.
14997014 The direct challenge of beta-adrenergic agonists to glioma cells resulted in the rapid and transient elevation of 5alpha-R mRNA levels through the activation of the cyclic AMP (cAMP)/protein kinase A-mediated signaling pathway.
14739525 Mutant SRD5A1 isoenzyme does not seem to play a crucial role in the development of hypospadias.
14671189 Changes in 5alpha-reductase, 11beta-HSD1, and 20alpha/beta-HSD enzyme activities observed in polycystic ovary syndrome may contribute to increased production of cortisol and androgens.
12738739 Loss of 5alpha-reductase type I expression is associated with metastatic prostate cancer
12670724 Observational study of gene-disease association. (HuGE Navigator)
12670724 polymorphisms of SRD5A1 and SRD5A2 genes may not be directly associated with the development of baldness or generation of different clinical phenotypes.
11948017 examination of differential methylation of isoenzyme genes in lymphocytes
11903314 role in blood pressure

AA Sequence

MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQ      1 - 70
YASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAV     71 - 140
YADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA    141 - 210
LASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF                         211 - 259
//

Text Mined References (89)

PMID Year Title
26174685 2015 Intraethnic variation in steroid-5-alpha-reductase polymorphismsin prostate cancer patients: a potential factor implicated in 5-alpha-reductase inhibitor treatment.
25960412 2015 Genetic variations in genes involved in testosterone metabolism are associated with prostate cancer progression: A Spanish multicenter study.
25850410 2015 Human sperm molecular anatomy: the enzyme 5?-reductase (SRD5A) is present in the sperm and may be involved in the varicocele-related infertility.
25475427 2015 The role of 5?-reductase type 1 associated with intratumoral dihydrotestosterone concentrations in human endometrial carcinoma.
25463305 2015 Important roles of the AKR1C2 and SRD5A1 enzymes in progesterone metabolism in endometrial cancer model cell lines.
24986533 2014 Longitudinal changes in glucocorticoid metabolism are associated with later development of adverse metabolic phenotype.
24277450 2014 Importance of 5?-reductase gene polymorphisms on circulating and intraprostatic androgens in prostate cancer.
24244276 2013 Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants.
23499746 2013 SRD5A1 and SRD5A2 are associated with treatment for benign prostatic hyperplasia with the combination of 5?-reductase inhibitors and ?-adrenergic receptor antagonists.
23183084 2013 Progestin effects on expression of AKR1C1-AKR1C3, SRD5A1 and PGR in the Z-12 endometriotic epithelial cell line.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22509838 2012 Selected variants of the steroid-5-alpha-reductase isoforms SRD5A1 and SRD5A2 and the sex steroid hormone receptors ESR1, ESR2 and PGR: no association with female pattern hair loss identified.
22273344 2012 SRD5A1 genotype frequency differences in women with mild versus severe premenstrual symptoms.
22194926 2011 Androgen regulation of 5?-reductase isoenzymes in prostate cancer: implications for prostate cancer prevention.
21947678 2012 Polymorphism Thr160Thr in SRD5A1, involved in the progesterone metabolism, modifies postmenopausal breast cancer risk associated with menopausal hormone therapy.
21795608 2011 Dihydrotestosterone synthesis bypasses testosterone to drive castration-resistant prostate cancer.
21715084 2011 SRD5A polymorphisms and biochemical failure after radical prostatectomy.
21676395 2011 Idiopathic hirsutism: local and peripheral expression of aromatase (CYP19A) and 5?-reductase genes (SRD5A1 and SRD5A2).
21530059 2011 Association of genetic variants in the two isoforms of 5?-reductase, SRD5A1 and SRD5A2, in lean patients with polycystic ovary syndrome.
21447938 2011 Pitfalls in the diagnosis of 5?-reductase type 2 deficiency during early infancy.
21323680 2011 Variation in genes encoding the neuroactive steroid synthetic enzymes 5?-reductase type 1 and 3?-reductase type 2 is associated with alcohol dependence.
20800085 2010 SRD5A2 is associated with increased cortisol metabolism in schizophrenia spectrum disorders.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20672519 [Family based association study of DRD1, DRD2, DRD3, DRD4, DAT, COMT gene polymorphism in schizophrenia].
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20519274 2010 Differential expression of steroid 5alpha-reductase isozymes and association with disease severity and angiogenic genes predict their biological role in prostate cancer.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20086173 2010 Evidence of limited contributions for intratumoral steroidogenesis in prostate cancer.
20056642 2010 Genetic variation of genes involved in dihydrotestosterone metabolism and the risk of prostate cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19886072 2009 Evaluation of 5-alpha reductase activity on cultured fibroblast in patients with hyperandrogenemia.
19846565 2009 Genetic variation in the progesterone receptor and metabolism pathways and hormone therapy in relation to breast cancer risk.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19383266 2009 Changes in human placental 5alpha-reductase isoenzyme expression with advancing gestation: effects of fetal sex and glucocorticoid exposure.
19246976 2008 Polymorphisms of steroid 5-alpha-reductase type I (SRD5A1) gene are associated to peripheral arterial disease.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18633104 2008 Impaired glucose tolerance and insulin resistance are associated with increased adipose 11beta-hydroxysteroid dehydrogenase type 1 expression and elevated hepatic 5alpha-reductase activity.
18483391 2008 VDR and SRD5A2 polymorphisms combine to increase risk for prostate cancer in both non-Hispanic White and Hispanic White men.
18422030 2008 Gender identity of children and young adults with 5alpha-reductase deficiency.
18258185 2008 Different patterns of 5alpha-reductase expression, cellular distribution, and testosterone metabolism in human follicular dermal papilla cells.
18215136 2008 Involvement of Egr-1 in HGF-induced elevation of the human 5alpha-R1 gene in human hepatocellular carcinoma cells.
18008328 2008 Oxytocin increases 5alpha-reductase activity of human prostate epithelial cells, but not stromal cells.
17986282 2008 Novel 5 alpha-steroid reductase (SRD5A3, type-3) is overexpressed in hormone-refractory prostate cancer.
17218734 2007 Adiposity, estradiol, and genetic variants of steroid-metabolizing enzymes as determinants of bone mineral density.
17066438 2007 5Alpha-reductase type 1 and aromatase in breast carcinoma as regulators of in situ androgen production.
16849416 2006 Variants in the 5alpha-reductase type 1 and type 2 genes are associated with polycystic ovary syndrome and the severity of hirsutism in affected women.
16818707 2006 Pharmacologic basis for the enhanced efficacy of dutasteride against prostatic cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16155734 2005 Androgenic correlates of genetic variation in the gene encoding 5alpha-reductase type 1.
16100771 2005 Gene analysis of steroid 5 alpha-reductase 1 in hyperandrogenic women.
15941927 2005 Isoenzyme type 1 of 5alpha-reductase is abundantly transcribed in normal human genital skin fibroblasts and may play an important role in masculinization of 5alpha-reductase type 2 deficient males.
15862960 2005 Regulation of aromatase and 5alpha-reductase by 25-hydroxyvitamin D(3), 1alpha,25-dihydroxyvitamin D(3), dexamethasone and progesterone in prostate cancer cells.
15792368 2005 5alpha-reductase in human embryonic kidney cell line HEK293: evidence for type II enzyme expression and activity.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15543614 2005 Serenoa repens (Permixon) inhibits the 5alpha-reductase activity of human prostate cancer cell lines without interfering with PSA expression.
15538746 2005 Differential alterations in 5alpha-reductase type 1 and type 2 levels during development and progression of prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15212687 2004 Expression of progesterone metabolizing enzyme genes (AKR1C1, AKR1C2, AKR1C3, SRD5A1, SRD5A2) is altered in human breast carcinoma.
15136785 2004 A case-based evaluation of SRD5A1, SRD5A2, AR, and ADRA1A as candidate genes for severity of BPH.
15004407 2004 Steroid 5alpha reductase mRNA type 1 is differentially regulated by androgens and glucocorticoids in the rat liver.
14997014 2004 Adrenergic activation of steroid 5alpha-reductase gene expression in rat C6 glioma cells: involvement of cyclic amp/protein kinase A-mediated signaling pathway.
14739525 2004 Steroid 5alpha-reductase 1 polymorphisms and testosterone/dihydrotestosterone ratio in male patients with hypospadias.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671189 2003 Altered cortisol metabolism in polycystic ovary syndrome: insulin enhances 5alpha-reduction but not the elevated adrenal steroid production rates.
12738739 2003 The loss of 5alpha-reductase type I and type II mRNA expression in metastatic prostate cancer to bone and lymph node metastasis.
12670724 2003 Analysis of genetic polymorphisms of steroid 5alpha-reductase type 1 and 2 genes in Korean men with androgenetic alopecia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11903314 2001 Sex, genes and blood pressure.
11678334 2001 New steroid 5alpha-reductase type I (SRD5A1) homologous sequences on human chromosomes 6 and 8.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9685215 1998 Prominent sex steroid metabolism in human lymphocytes.
9620288 1998 Genetic analysis of male pattern baldness and the 5alpha-reductase genes.
9110174 1997 Large-scale concatenation cDNA sequencing.
8876709 1996 Differential expression of 5 alpha-reductase isoenzymes in the human prostate and prostatic carcinomas.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8389478 1993 LY191704: a selective, nonsteroidal inhibitor of human steroid 5 alpha-reductase type 1.
7796940 1995 Activin and inhibin have opposite effects on steroid 5 alpha-reductase activity in genital skin fibroblasts.
7688765 1993 Tissue distribution and ontogeny of steroid 5 alpha-reductase isozyme expression.
6833469 1983 Androstenedione metabolism in human alveolar macrophages.
4400474 1972 Localization of the reduced nicotinamide adenine dinucleotide phosphate: 4 -3-ketosteroid 5 -oxidoreductase in the nuclear membrane of the rat ventral prostate.
2339109 1990 Structural and biochemical properties of cloned and expressed human and rat steroid 5 alpha-reductases.
1686016 1991 Characterization and chromosomal mapping of a human steroid 5 alpha-reductase gene and pseudogene and mapping of the mouse homologue.
1345916 1992 Genetic and pharmacological evidence for more than one human steroid 5 alpha-reductase.