| Tclin | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]
Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]
Comments
| Disease | Target Count |
|---|---|
| Polycystic Ovary Syndrome | 334 |
| Endometriosis | 535 |
| Peripheral Neuropathy | 303 |
| Prostatic Neoplasms | 471 |
| Disease | Target Count |
|---|---|
| Benign prostatic hyperplasia | 7 |
| Male Patterned Baldness | 2 |
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2798 | 8.7e-25 |
| lung carcinoma | 2844 | 2.0e-24 |
| pilocytic astrocytoma | 3086 | 4.4e-11 |
| tuberculosis | 1563 | 9.0e-09 |
| glioblastoma | 5572 | 1.6e-08 |
| lung adenocarcinoma | 2714 | 3.9e-07 |
| atypical teratoid / rhabdoid tumor | 4369 | 3.9e-06 |
| lung cancer | 4473 | 6.0e-05 |
| adult high grade glioma | 2148 | 6.0e-05 |
| pancreatic cancer | 2300 | 2.5e-04 |
| adrenocortical carcinoma | 1427 | 2.8e-04 |
| ovarian cancer | 8491 | 5.3e-04 |
| ductal carcinoma in situ | 1745 | 7.8e-04 |
| astrocytic glioma | 2241 | 1.6e-03 |
| Pick disease | 1893 | 1.9e-03 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 2.9e-03 |
| ependymoma | 2514 | 3.2e-03 |
| oligodendroglioma | 2849 | 4.2e-03 |
| medulloblastoma, large-cell | 6234 | 4.5e-03 |
| invasive ductal carcinoma | 2950 | 7.0e-03 |
| intraductal papillary-mucinous adenoma (IPMA) | 2956 | 9.7e-03 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 1.8e-02 |
| colon cancer | 1475 | 3.5e-02 |
| esophageal adenocarcinoma | 737 | 4.0e-02 |
| Parkinson's disease | 364 | 4.6e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Prostate cancer | 172 | 4.042 | 2.0 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytic glioma | -3.300 | 1.6e-03 |
| ependymoma | -3.500 | 3.2e-03 |
| oligodendroglioma | -3.000 | 4.2e-03 |
| esophageal adenocarcinoma | -1.400 | 4.0e-02 |
| glioblastoma | -2.800 | 1.6e-08 |
| atypical teratoid / rhabdoid tumor | -2.800 | 3.9e-06 |
| medulloblastoma, large-cell | -1.200 | 4.5e-03 |
| adrenocortical carcinoma | 1.763 | 2.8e-04 |
| tuberculosis | 2.000 | 9.0e-09 |
| non-small cell lung cancer | 2.731 | 8.7e-25 |
| intraductal papillary-mucinous adenoma (... | 1.400 | 9.7e-03 |
| intraductal papillary-mucinous carcinoma... | 1.200 | 1.8e-02 |
| intraductal papillary-mucinous neoplasm ... | 2.500 | 2.9e-03 |
| lung cancer | 2.000 | 6.0e-05 |
| colon cancer | 1.300 | 3.5e-02 |
| Parkinson's disease | -1.200 | 4.6e-02 |
| pancreatic cancer | 1.100 | 2.5e-04 |
| adult high grade glioma | -3.100 | 6.0e-05 |
| pilocytic astrocytoma | -3.800 | 4.4e-11 |
| lung adenocarcinoma | 1.896 | 3.9e-07 |
| lung carcinoma | 1.400 | 2.0e-24 |
| Pick disease | -1.500 | 1.9e-03 |
| ductal carcinoma in situ | 2.300 | 7.8e-04 |
| invasive ductal carcinoma | 2.800 | 7.0e-03 |
| ovarian cancer | 2.100 | 5.3e-04 |
CHEMBL183692
pIC50 6.00
CHEMBL333684
pIC50 6.00
CHEMBL78161
pKi 6.00
CHEMBL16248
pIC50 6.00
CHEMBL278049
pIC50 6.00
CHEMBL77650
pIC50 6.00
CHEMBL283564
pIC50 6.01
CHEMBL116370
pIC50 6.02
CHEMBL118283
pIC50 6.03
CHEMBL97266
pKi 6.04
CHEMBL136097
pIC50 6.05
CHEMBL137040
pIC50 6.05
CHEMBL248682
pIC50 6.08
CHEMBL77169
pIC50 6.09
CHEMBL76192
pKi 6.09
CHEMBL76648
pKi 6.13
CHEMBL119722
pIC50 6.14
CHEMBL136863
pKi 6.14
CHEMBL182399
pIC50 6.15
CHEMBL24464
pIC50 6.15
| PMID | Text | |
|---|---|---|
| 26174685 | the genotypic distribution of 22 single nucleotide polymorphisms in SRD5A1 and SRD5A2 in a set of Spanish prostate cancer patients, were evaluated. | |
| 25960412 | A total of 2 SNPs in SRD5A1-rs3822430 and rs1691053-were associated with prostate-specific antigen level at diagnosis. | |
| 25850410 | study found SRD5A enzyme is present in spermatozoa and that its cellular content is lowered in sperm samples from varicocele patients compared to healthy subjects | |
| 25475427 | Results show that 5alpha-reductase type 1 was associated with intratumoral dihydrotestosterone concentrations and is an independent prognostic factor in endometrioid endometrial adenocarcinoma. | |
| 25463305 | In model cell lines of endometrial cancer, AKR1C2 and SRD5A1 have crucial roles in progesterone metabolism. | |
| 24986533 | Increased 5alphaR activity and glucocorticoid secretion rate over time are linked with the development of metabolic disease, and may represent targets for therapeutic intervention. | |
| 24277450 | SRD5A1 rs166050C risk variant was associated with greater prostatic exposure to androsterone | |
| 24244276 | Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue | |
| 23499746 | SRD5A1 and SRD5A2 single nucleotide polymorphisms are significantly associated with the clinical characteristics of benign prostatic hyperplasia and the efficacy of benign prostatic hyperplasia treatment. | |
| 23183084 | Different effects were seen for progesterone, which significantly decreased SRD5A1 protein levels. | |
| 22509838 | Based on a limited selection of gene variants, no involvement of SRD5A1, SRD5A2, ESR1, ESR2 or PGR in female pattern hair loss is evident. | |
| 22273344 | Ten percent of cases and 44% of controls had the cytosine/cytosine (C/C) genotype for the SRD5A1 SNP, rs501999 indicating that this genotype may protect women against severe premenstrual symptoms. | |
| 22194926 | The different expression levels of 5alpha-reductase isoenzymes may confer response or resistance to 5alpha-reductase inhibitors. | |
| 21947678 | Postmenopausal breast cancer risk associated with combined therapy may be modified by genetic variation in SRD5A1 | |
| 21795608 | the dominant route of Dihydrotestosterone synthesis in castration-resistant prostate cancer bypasses testosterone, and instead requires 5alpha-reduction of androstenedione by SRD5A1 to 5alpha-androstanedione, which is then converted to DHT | |
| 21715084 | Show positive associations of several SRD5A1 and SRD5A2 variations as independent predictors of biochemical recurrence after radical prostatectomy. | |
| 21676395 | A statistically significant reduction of SRD5A1, SRD5A2, and CYP19A gene expression was found in the dermal papillae cells and peripheral blood mononuclear cells in idiopathic hirsutism. | |
| 21530059 | Single nucleotide polymorphisms in the two isoforms of 5alpha-reductase, SRD5A1 and SRD5A2, are associated with lean patients with polycystic ovary syndrome. | |
| 21447938 | Pitfalls in the diagnosis of 5alpha-reductase type 2 deficiency during early infancy. | |
| 21323680 | Evidence of association of two alleles for alcohol dependence (AD) is found in SRD5A1 and AKR1C3, mediating a protective effect of the minor allele at each AD marker based on the genotype of the second marker. | |
| 20800085 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20734064 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20672519 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20634197 | Meta-analysis of gene-disease association. (HuGE Navigator) | |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 20519274 | High nuclear SRD5A1 expression is associated with higher prostate cancer stage. | |
| 20214802 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20200332 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20086173 | Data indicate that enzymes CYP17A1 and HSD3B1 showed low expression, while AKR1C3 and SRD5A1 were abundantly expressed. | |
| 20056642 | We investigated associations between single nucleotide polymorphisms in genes HSD3B1, SRD5A1/2, and AKR1C2 and prostate cancer risk | |
| 20056642 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19886072 | hyperandrogenemia is associated with high levels of expression of 5-alpha reductase type 1 and, to a less extent, of type 2 isoenzyme in pubian skin cultured fibroblasts | |
| 19846565 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 19598235 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19574343 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19383266 | Report changes in human placental 5alpha-reductase isoenzyme expression with advancing gestation: effects of fetal sex and glucocorticoid exposure. | |
| 19246976 | A decreased local enzymatic conversion of testosterone may contribute to PAD genetic susceptibility. | |
| 19246976 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19064572 | Observational study and meta-analysis of gene-disease association. (HuGE Navigator) | |
| 18636124 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18633104 | Enhanced 5alphaR activity in both sexes is associated with insulin resistance but not body composition | |
| 18483391 | the SRD5A2 V89L VV genotype interacts with VDR FokI TT/CT genotypes in non-Hispanic White men and VDR CDX2 GG genotypes in Hispanic White men to increase the risk for prostate cancer. | |
| 18422030 | Testosterone 5-alpha-Reductase deficiency is associated with gender identity | |
| 18258185 | Our results demonstrate that the 5alphaR activities of either bDPCs or sDPCs are stronger than that of dermal fibroblasts, despite the fact that the major steroidogenic activity is attributed to 17beta-HSD rather than 5alphaR among the three cell types. | |
| 18215136 | Hepatocyte growth factor stimulates 5alpha-R1 expression through up-regulation of the transcription factor early growth response 1 | |
| 18008328 | Both 5-alpha-reductase I and II are expressed in normal human prostate stromal and epithelial cells. Only 5-alpha-reductase isoenzymes of prostate epithelium are modulated by oxytocin. | |
| 17218734 | Observational study of gene-disease association. (HuGE Navigator) | |
| 17066438 | These results suggest that intratumoral 5 alpha-dihydrotestosterone concentration is mainly determined by 5alphaRed1 and aromatase in breast carcinoma tissues. | |
| 16849416 | Observational study of gene-disease association. (HuGE Navigator) | |
| 16818707 | The SRD5A1 mRNA expression is 2-fold lower than SRD5A2 in normal rat. | |
| 16155734 | Observational study of gene-disease association. (HuGE Navigator) | |
| 16100771 | Observational study of gene-disease association. (HuGE Navigator) | |
| 15941927 | SRD5A1 is abundantly transcribed in normal human genital skin fibroblasts and may play an important role in masculinization of SRD5A2-deficient males. | |
| 15862960 | The expression of 5alpha-reductase type I mRNA was not regulated by calcitriol in a prostate tumor cell line. | |
| 15792368 | 5alpha-reductase is expresed in human embryonic kidney cell line HEK293 | |
| 15543614 | Serenoa repens inhibits this enzyme in the prostate, but does not suppress prostate-specific antigen secretion in prostate cancer. | |
| 15538746 | 5alpha-reductase type 1 (5alphaR1) immunostaining is increased and 5alpha-reductase type 2(5alphaR2) immunostaining is decreased during development of prostate cancer and there is increased expression of both in recurrent and metastatic cancers | |
| 15212687 | Expression of SRD5A1 (5alphaR1) and SRD5A2 (5alphaR2) is elevated, and expression of AKR1C1 (20alpha-HSO), AKR1C2 (3alpha-HSO3) and AKR1C3 (3alpha-HSO2) is reduced in tumorous as compared to normal breast tissue. | |
| 15136785 | Observational study of gene-disease association. (HuGE Navigator) | |
| 15136785 | Candidate gene for benign prostatic hyperplasia. | |
| 15004407 | Glucocorticoids and androgens differentially regulate 5alphaR1 mRNA in the rat liver. Regulation of 5alphaR1 gene is primarily at the post-transcriptional level. | |
| 14997014 | The direct challenge of beta-adrenergic agonists to glioma cells resulted in the rapid and transient elevation of 5alpha-R mRNA levels through the activation of the cyclic AMP (cAMP)/protein kinase A-mediated signaling pathway. | |
| 14739525 | Mutant SRD5A1 isoenzyme does not seem to play a crucial role in the development of hypospadias. | |
| 14671189 | Changes in 5alpha-reductase, 11beta-HSD1, and 20alpha/beta-HSD enzyme activities observed in polycystic ovary syndrome may contribute to increased production of cortisol and androgens. | |
| 12738739 | Loss of 5alpha-reductase type I expression is associated with metastatic prostate cancer | |
| 12670724 | Observational study of gene-disease association. (HuGE Navigator) | |
| 12670724 | polymorphisms of SRD5A1 and SRD5A2 genes may not be directly associated with the development of baldness or generation of different clinical phenotypes. | |
| 11948017 | examination of differential methylation of isoenzyme genes in lymphocytes | |
| 11903314 | role in blood pressure |
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQ 1 - 70 YASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAV 71 - 140 YADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA 141 - 210 LASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF 211 - 259 //
| PMID | Year | Title | |
|---|---|---|---|
| 26174685 | 2015 | Intraethnic variation in steroid-5-alpha-reductase polymorphismsin prostate cancer patients: a potential factor implicated in 5-alpha-reductase inhibitor treatment. | |
| 25960412 | 2015 | Genetic variations in genes involved in testosterone metabolism are associated with prostate cancer progression: A Spanish multicenter study. | |
| 25850410 | 2015 | Human sperm molecular anatomy: the enzyme 5?-reductase (SRD5A) is present in the sperm and may be involved in the varicocele-related infertility. | |
| 25475427 | 2015 | The role of 5?-reductase type 1 associated with intratumoral dihydrotestosterone concentrations in human endometrial carcinoma. | |
| 25463305 | 2015 | Important roles of the AKR1C2 and SRD5A1 enzymes in progesterone metabolism in endometrial cancer model cell lines. | |
| 24986533 | 2014 | Longitudinal changes in glucocorticoid metabolism are associated with later development of adverse metabolic phenotype. | |
| 24277450 | 2014 | Importance of 5?-reductase gene polymorphisms on circulating and intraprostatic androgens in prostate cancer. | |
| 24244276 | 2013 | Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants. | |
| 23499746 | 2013 | SRD5A1 and SRD5A2 are associated with treatment for benign prostatic hyperplasia with the combination of 5?-reductase inhibitors and ?-adrenergic receptor antagonists. | |
| 23183084 | 2013 | Progestin effects on expression of AKR1C1-AKR1C3, SRD5A1 and PGR in the Z-12 endometriotic epithelial cell line. | |
| 22952603 | 2012 | Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13). | |
| 22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. | |
| 22589738 | 2012 | Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women. | |
| 22509838 | 2012 | Selected variants of the steroid-5-alpha-reductase isoforms SRD5A1 and SRD5A2 and the sex steroid hormone receptors ESR1, ESR2 and PGR: no association with female pattern hair loss identified. | |
| 22273344 | 2012 | SRD5A1 genotype frequency differences in women with mild versus severe premenstrual symptoms. | |
| 22194926 | 2011 | Androgen regulation of 5?-reductase isoenzymes in prostate cancer: implications for prostate cancer prevention. | |
| 21947678 | 2012 | Polymorphism Thr160Thr in SRD5A1, involved in the progesterone metabolism, modifies postmenopausal breast cancer risk associated with menopausal hormone therapy. | |
| 21795608 | 2011 | Dihydrotestosterone synthesis bypasses testosterone to drive castration-resistant prostate cancer. | |
| 21715084 | 2011 | SRD5A polymorphisms and biochemical failure after radical prostatectomy. | |
| 21676395 | 2011 | Idiopathic hirsutism: local and peripheral expression of aromatase (CYP19A) and 5?-reductase genes (SRD5A1 and SRD5A2). | |
| 21530059 | 2011 | Association of genetic variants in the two isoforms of 5?-reductase, SRD5A1 and SRD5A2, in lean patients with polycystic ovary syndrome. | |
| 21447938 | 2011 | Pitfalls in the diagnosis of 5?-reductase type 2 deficiency during early infancy. | |
| 21323680 | 2011 | Variation in genes encoding the neuroactive steroid synthetic enzymes 5?-reductase type 1 and 3?-reductase type 2 is associated with alcohol dependence. | |
| 20800085 | 2010 | SRD5A2 is associated with increased cortisol metabolism in schizophrenia spectrum disorders. | |
| 20734064 | 2010 | A large-scale candidate gene association study of age at menarche and age at natural menopause. | |
| 20672519 | [Family based association study of DRD1, DRD2, DRD3, DRD4, DAT, COMT gene polymorphism in schizophrenia]. | ||
| 20634197 | 2010 | Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium. | |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. | |
| 20519274 | 2010 | Differential expression of steroid 5alpha-reductase isozymes and association with disease severity and angiogenic genes predict their biological role in prostate cancer. | |
| 20214802 | 2010 | Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer. | |
| 20200332 | 2010 | Family-based analysis of candidate genes for polycystic ovary syndrome. | |
| 20086173 | 2010 | Evidence of limited contributions for intratumoral steroidogenesis in prostate cancer. | |
| 20056642 | 2010 | Genetic variation of genes involved in dihydrotestosterone metabolism and the risk of prostate cancer. | |
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. | |
| 19886072 | 2009 | Evaluation of 5-alpha reductase activity on cultured fibroblast in patients with hyperandrogenemia. | |
| 19846565 | 2009 | Genetic variation in the progesterone receptor and metabolism pathways and hormone therapy in relation to breast cancer risk. | |
| 19598235 | 2009 | Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome. | |
| 19574343 | 2009 | Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3). | |
| 19383266 | 2009 | Changes in human placental 5alpha-reductase isoenzyme expression with advancing gestation: effects of fetal sex and glucocorticoid exposure. | |
| 19246976 | 2008 | Polymorphisms of steroid 5-alpha-reductase type I (SRD5A1) gene are associated to peripheral arterial disease. | |
| 19064572 | 2008 | Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women. | |
| 18636124 | 2008 | Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma. | |
| 18633104 | 2008 | Impaired glucose tolerance and insulin resistance are associated with increased adipose 11beta-hydroxysteroid dehydrogenase type 1 expression and elevated hepatic 5alpha-reductase activity. | |
| 18483391 | 2008 | VDR and SRD5A2 polymorphisms combine to increase risk for prostate cancer in both non-Hispanic White and Hispanic White men. | |
| 18422030 | 2008 | Gender identity of children and young adults with 5alpha-reductase deficiency. | |
| 18258185 | 2008 | Different patterns of 5alpha-reductase expression, cellular distribution, and testosterone metabolism in human follicular dermal papilla cells. | |
| 18215136 | 2008 | Involvement of Egr-1 in HGF-induced elevation of the human 5alpha-R1 gene in human hepatocellular carcinoma cells. | |
| 18008328 | 2008 | Oxytocin increases 5alpha-reductase activity of human prostate epithelial cells, but not stromal cells. | |
| 17986282 | 2008 | Novel 5 alpha-steroid reductase (SRD5A3, type-3) is overexpressed in hormone-refractory prostate cancer. | |
| 17218734 | 2007 | Adiposity, estradiol, and genetic variants of steroid-metabolizing enzymes as determinants of bone mineral density. | |
| 17066438 | 2007 | 5Alpha-reductase type 1 and aromatase in breast carcinoma as regulators of in situ androgen production. | |
| 16849416 | 2006 | Variants in the 5alpha-reductase type 1 and type 2 genes are associated with polycystic ovary syndrome and the severity of hirsutism in affected women. | |
| 16818707 | 2006 | Pharmacologic basis for the enhanced efficacy of dutasteride against prostatic cancers. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 16155734 | 2005 | Androgenic correlates of genetic variation in the gene encoding 5alpha-reductase type 1. | |
| 16100771 | 2005 | Gene analysis of steroid 5 alpha-reductase 1 in hyperandrogenic women. | |
| 15941927 | 2005 | Isoenzyme type 1 of 5alpha-reductase is abundantly transcribed in normal human genital skin fibroblasts and may play an important role in masculinization of 5alpha-reductase type 2 deficient males. | |
| 15862960 | 2005 | Regulation of aromatase and 5alpha-reductase by 25-hydroxyvitamin D(3), 1alpha,25-dihydroxyvitamin D(3), dexamethasone and progesterone in prostate cancer cells. | |
| 15792368 | 2005 | 5alpha-reductase in human embryonic kidney cell line HEK293: evidence for type II enzyme expression and activity. | |
| 15583024 | 2004 | Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones. | |
| 15543614 | 2005 | Serenoa repens (Permixon) inhibits the 5alpha-reductase activity of human prostate cancer cell lines without interfering with PSA expression. | |
| 15538746 | 2005 | Differential alterations in 5alpha-reductase type 1 and type 2 levels during development and progression of prostate cancer. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15212687 | 2004 | Expression of progesterone metabolizing enzyme genes (AKR1C1, AKR1C2, AKR1C3, SRD5A1, SRD5A2) is altered in human breast carcinoma. | |
| 15136785 | 2004 | A case-based evaluation of SRD5A1, SRD5A2, AR, and ADRA1A as candidate genes for severity of BPH. | |
| 15004407 | 2004 | Steroid 5alpha reductase mRNA type 1 is differentially regulated by androgens and glucocorticoids in the rat liver. | |
| 14997014 | 2004 | Adrenergic activation of steroid 5alpha-reductase gene expression in rat C6 glioma cells: involvement of cyclic amp/protein kinase A-mediated signaling pathway. | |
| 14739525 | 2004 | Steroid 5alpha-reductase 1 polymorphisms and testosterone/dihydrotestosterone ratio in male patients with hypospadias. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 14671189 | 2003 | Altered cortisol metabolism in polycystic ovary syndrome: insulin enhances 5alpha-reduction but not the elevated adrenal steroid production rates. | |
| 12738739 | 2003 | The loss of 5alpha-reductase type I and type II mRNA expression in metastatic prostate cancer to bone and lymph node metastasis. | |
| 12670724 | 2003 | Analysis of genetic polymorphisms of steroid 5alpha-reductase type 1 and 2 genes in Korean men with androgenetic alopecia. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11903314 | 2001 | Sex, genes and blood pressure. | |
| 11678334 | 2001 | New steroid 5alpha-reductase type I (SRD5A1) homologous sequences on human chromosomes 6 and 8. | |
| 10931946 | 2000 | Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. | |
| 9685215 | 1998 | Prominent sex steroid metabolism in human lymphocytes. | |
| 9620288 | 1998 | Genetic analysis of male pattern baldness and the 5alpha-reductase genes. | |
| 9110174 | 1997 | Large-scale concatenation cDNA sequencing. | |
| 8876709 | 1996 | Differential expression of 5 alpha-reductase isoenzymes in the human prostate and prostatic carcinomas. | |
| 8619474 | 1996 | A "double adaptor" method for improved shotgun library construction. | |
| 8389478 | 1993 | LY191704: a selective, nonsteroidal inhibitor of human steroid 5 alpha-reductase type 1. | |
| 7796940 | 1995 | Activin and inhibin have opposite effects on steroid 5 alpha-reductase activity in genital skin fibroblasts. | |
| 7688765 | 1993 | Tissue distribution and ontogeny of steroid 5 alpha-reductase isozyme expression. | |
| 6833469 | 1983 | Androstenedione metabolism in human alveolar macrophages. | |
| 4400474 | 1972 | Localization of the reduced nicotinamide adenine dinucleotide phosphate: 4 -3-ketosteroid 5 -oxidoreductase in the nuclear membrane of the rat ventral prostate. | |
| 2339109 | 1990 | Structural and biochemical properties of cloned and expressed human and rat steroid 5 alpha-reductases. | |
| 1686016 | 1991 | Characterization and chromosomal mapping of a human steroid 5 alpha-reductase gene and pseudogene and mapping of the mouse homologue. | |
| 1345916 | 1992 | Genetic and pharmacological evidence for more than one human steroid 5 alpha-reductase. |
