Tclin 3-oxo-5-alpha-steroid 4-dehydrogenase 1

Add to cart

View Collections

Empty Collection

Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.

Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]

Comments

Property Summary

Ligand Count	327
NCBI Gene PubMed Count	92
PubMed Score	90.66

PubTator Score	1570.70

Knowledge Summary

Patent

No data available

TINX Plot

Disease (5)

Disease	Target Count	Z-score	Confidence
Endometriosis	540	0.0	0.0
Liver Cirrhosis, Experimental	769	0.0	0.0
Polycystic ovary syndrome	360	0.0	0.0
Prostatic Neoplasms	495	0.0	0.0

Disease	Target Count
Alcoholic Intoxication, Chronic	289
Bipolar Disorder	666
Depressive disorder	409
Manic	14
Manic mood	6
Mental Depression	333

Disease	Target Count
Benign prostatic hyperplasia	7
Male Patterned Baldness	2

Disease	Target Count	P-value
non-small cell lung cancer	2890	8.7e-25
lung carcinoma	2843	2.0e-24
Astrocytoma, Pilocytic	3081	3.4e-11
glioblastoma	5792	1.6e-08
tuberculosis	2010	3.0e-07
lung adenocarcinoma	2716	3.9e-07
atypical teratoid / rhabdoid tumor	5112	3.9e-06
adult high grade glioma	3801	6.0e-05
pancreatic cancer	2398	2.5e-04
adrenocortical carcinoma	1428	2.8e-04
ductal carcinoma in situ	1745	7.8e-04
astrocytic glioma	2597	1.6e-03
Pick disease	1894	1.9e-03
intraductal papillary-mucinous neoplasm (IPMN)	3291	2.9e-03
ependymoma	4679	3.2e-03
oligodendroglioma	2850	4.2e-03
medulloblastoma, large-cell	6241	4.5e-03
invasive ductal carcinoma	2951	7.0e-03
intraductal papillary-mucinous adenoma (IPMA)	2955	9.7e-03
intraductal papillary-mucinous carcinoma (IPMC)	2989	1.8e-02
lung cancer	4740	1.8e-02
ovarian cancer	8520	3.1e-02
colon cancer	1478	3.5e-02
esophageal adenocarcinoma	737	4.0e-02
Parkinson's disease	392	4.6e-02

Disease	Target Count	Z-score	Confidence
Prostate cancer	175	4.092	2.0

Differential Expression (25)

Disease	log2 FC	p
adrenocortical carcinoma	1.763	2.8e-04
adult high grade glioma	-3.100	6.0e-05
astrocytic glioma	-3.300	1.6e-03
Astrocytoma, Pilocytic	-3.800	3.4e-11
atypical teratoid / rhabdoid tumor	-2.800	3.9e-06
colon cancer	1.300	3.5e-02
ductal carcinoma in situ	2.300	7.8e-04
ependymoma	-3.500	3.2e-03
esophageal adenocarcinoma	-1.400	4.0e-02
glioblastoma	-2.800	1.6e-08
intraductal papillary-mucinous adenoma (...	1.400	9.7e-03
intraductal papillary-mucinous carcinoma...	1.200	1.8e-02
intraductal papillary-mucinous neoplasm ...	2.500	2.9e-03
invasive ductal carcinoma	2.800	7.0e-03
lung adenocarcinoma	1.896	3.9e-07
lung cancer	1.200	1.8e-02
lung carcinoma	1.400	2.0e-24
medulloblastoma, large-cell	-1.200	4.5e-03
non-small cell lung cancer	2.731	8.7e-25
oligodendroglioma	-3.000	4.2e-03
ovarian cancer	1.100	3.1e-02
pancreatic cancer	1.100	2.5e-04
Parkinson's disease	-1.200	4.6e-02
Pick disease	-1.500	1.9e-03
tuberculosis	1.700	3.0e-07

Esophagus - Mucosa 18,076

Skin - Not Sun Exposed (Suprapubic) 18,081

Skin - Sun Exposed (Lower leg) 17,968

Liver 18,071

Vagina 17,834

Cells - EBV-transformed lymphocytes 18,186

Brain - Frontal Cortex (BA9) 18,069

Brain - Cerebellar Hemisphere 18,015

Cells - Transformed fibroblasts 17,577

Small Intestine - Terminal Ileum 17,954

Ovary 17,971

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Cerebellum 17,983

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Hypothalamus 18,169

Brain - Hippocampus 18,011

Brain - Amygdala 18,006

Brain - Cortex 18,039

Artery - Aorta 17,896

Uterus 17,618

Brain - Caudate (basal ganglia) 18,001

Brain - Substantia nigra 17,981

Colon - Transverse 17,825

Nerve - Tibial 18,007

Brain - Spinal cord (cervical c-1) 17,973

Artery - Tibial 17,631

Artery - Coronary 17,949

Minor Salivary Gland 18,005

Brain - Putamen (basal ganglia) 17,863

Pituitary 18,147

Adipose - Subcutaneous 18,110

Kidney - Cortex 17,329

Breast - Mammary Tissue 18,103

Colon - Sigmoid 18,089

Prostate 18,213

Adipose - Visceral (Omentum) 17,937

Spleen 17,614

Thyroid 18,024

Testis 18,518

Lung 18,057

Esophagus - Gastroesophageal Junction 18,000

Stomach 17,879

Esophagus - Muscularis 18,017

Adrenal Gland 18,071

Whole Blood 17,439

Pancreas 18,123

Heart - Atrial Appendage 17,896

Muscle - Skeletal 17,778

Heart - Left Ventricle 18,006

Fetal Testis 7,955

Monocytes 7,422

Fetal Heart 9,228

Adult Liver 9,113

NK Cells 8,475

Adult Kidney 6,723

Fetal Brain 7,866

Adult Adrenal 8,475

Adult Colon 7,915

Adrenal gland

Brain

Colon

Heart

Kidney

Liver

Monocyte

Natural killer cell

Placenta 6,083

Testis

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Adrenal gland 177

Brain 7,346

Eye 856

Hippocampus 531

Urinary bladder 228

See source...

Leydig cell 54

Harderian gland 7

See source...

Synonym

Accession	P18405 B2R7Q1 Q9UHY4 Q9UP36 Q9UP37
Symbols	S5AR 1

Gene

SRD5A1

PANTHER Protein Class (2)

oxidoreductase 319

dehydrogenase 173

Ortholog (13)

Species	Source	Disease
Chicken 7,827	OMA EggNOG
Xenopus 10,468	Inparanoid OMA EggNOG
Pig 10,168	OMA EggNOG
Opossum 12,230	Inparanoid OMA EggNOG
Zebrafish 9,726	Inparanoid EggNOG
C. elegans 3,179	OMA EggNOG
Macaque 12,761	Inparanoid OMA EggNOG
Mouse 16,570	Inparanoid OMA EggNOG
Chimp 14,140	OMA EggNOG
Horse 14,252	Inparanoid OMA EggNOG
Cow 15,320	Inparanoid OMA EggNOG
Rat 15,117	Inparanoid OMA EggNOG
Dog 15,073	Inparanoid OMA EggNOG

UniProt Keyword (11)

Complete proteome 20,231

Reference proteome 20,231

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

Endoplasmic reticulum 1,119

Microsome 129

Oxidoreductase 571

Differentiation 703

NADP 189

See all...

GO Function (5)

electron transfer activity 73

amide binding 3

NADPH binding 13

3-oxo-5-alpha-steroid 4-dehydrogenase ac... 3

cholestenone 5-alpha-reductase activity 3

GO Component (7)

integral component of membrane 3,665

endoplasmic reticulum membrane 879

organelle membrane 86

perinuclear region of cytoplasm 644

neuronal cell body 325

myelin sheath 144

cell body fiber 7

GO Process (33)

cellular response to estradiol stimulus 38

response to drug 303

cell differentiation 511

cellular response to insulin stimulus 79

male gonad development 94

cerebral cortex development 62

cellular response to growth factor stimu... 45

cellular response to cAMP 51

bone development 43

cellular response to starvation 57

See all...

Compartment GO Term (23)

Cell 16,178

Cell part 16,177

Cytoplasm 10,983

Cytoplasmic part 9,247

Endomembrane system 4,237

Endoplasmic reticulum 2,001

Endoplasmic reticulum membrane 1,103

Endoplasmic reticulum part 1,359

Integral component of membrane 5,331

Intracellular 14,109

Intracellular membrane-bounded organelle 10,341

Intracellular organelle 12,025

Intracellular organelle part 8,783

Intracellular part 13,972

Intrinsic component of membrane 5,458

See all...

MGI Phenotype (2)

endocrine-exocrine gland phenotype 2,293

reproductive system phenotype 1,999

GWAS Trait (1)

Response to amphetamines 53

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Pathway (11)

Steroid hormone biosynthesis 58

http://pathwaycommons.org/pc2/Pathway_92... 7

http://identifiers.org/smpdb/SMP00068 12

http://identifiers.org/smpdb/SMP00356 12

http://identifiers.org/smpdb/SMP00565 12

Metabolism 2,081

Metabolism of lipids 739

Metabolism of steroids 154

Metabolism of steroid hormones 34

Steroid hormones 45

See all...

See all 325 ligands...

Gene RIF (75)

AA Sequence

MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQ      1 - 70
YASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAV     71 - 140
YADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA    141 - 210
LASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF                         211 - 259
//

Text Mined References (94)

Summary
Details

	PMID	Year	Title

Tclin 3-oxo-5-alpha-steroid 4-dehydrogenase 1 Add to cart View Collections Empty Collection

Property Summary

Knowledge Summary

Patent

No data available

TINX Plot

Disease (5)

Expression

Differential Expression (25)

Synonym

Gene

PANTHER Protein Class (2)

Ortholog (13)

UniProt Keyword (11)

GO Function (5)

GO Component (7)

GO Process (33)

Compartment GO Term (23)

MGI Phenotype (2)

GWAS Trait (1)

HCA RNA Cell Line (56)

Pathway (11)

Protein-protein Interaction (1)

Drug (2)

Ligand (325)

Gene RIF (75)

AA Sequence

Text Mined References (94)

Tclin 3-oxo-5-alpha-steroid 4-dehydrogenase 1

Add to cart

View Collections

Empty Collection