Property Summary

NCBI Gene PubMed Count 969
PubMed Score 8801.01
PubTator Score 3297.81

Knowledge Summary

Patent (365,075)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.900 1.1e-04
osteosarcoma 3.039 2.4e-07
tuberculosis -1.500 3.6e-05
group 4 medulloblastoma 1.100 1.1e-04
COPD -1.200 2.7e-03
ovarian cancer -1.100 1.6e-07

Synonym

Accession P12931 E1P5V4 Q76P87 Q86VB9 Q9H5A8
Symbols ASV
SRC1
THC6
c-SRC
p60-Src

Gene

SRC

PDB

3VRO   1A07   1A08   1A09   1A1A   1A1B   1A1C   1A1E   1FMK   1HCS   1HCT   1KSW   1O41   1O42   1O43   1O44   1O45   1O46   1O47   1O48   1O49   1O4A   1O4B   1O4C   1O4D   1O4E   1O4F   1O4G   1O4H   1O4I   1O4J   1O4K   1O4L   1O4M   1O4N   1O4O   1O4P   1O4Q   1O4R   1SHD   1Y57   1YI6   1YOJ   1YOL   1YOM   2BDF   2BDJ   2H8H   2SRC   3ZMP   3ZMQ   4F59   4F5A   4F5B   4HXJ   4K11   4MXO   4MXX   4MXY   4MXZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (580)

PMID Text
27097314 FGF-2, VEGF-A, and HIV-Tat, may affect the glomerular filtration barrier in HIV+ children through the induction of synergistic changes in Rho-A and Src activity
26923073 Collectively, our data demonstrate that DCMF induces cell migration and promotes wound healing through activation of Src/FAK, ERK, AKT, and p38 MAPK signaling.
26866924 Src has a role in priming Pyk2 (but not FAK) phosphorylation and subsequent activation downstream of integrins
26866809 regulation of c-Src trafficking requires both microtubules and actin polymerization, and GEF-H1 coordinates c-Src trafficking, acting as a molecular switch between these two mechanisms
26549523 This study describes a pro-metastatic EGFR/Src-dependent beta4 integrin/FAK complex that is involved in breast cancer malignancy and is a novel therapeutic target for triple-negative breast cancer.
26460485 SRC, LYN and CKB expression or DNA methylation could be useful markers for predicting tumor progression.
26399481 Data suggest that tyrosine-phosphorylated CaM (calmodulin) elicits strong up-regulation in ligand-dependent activity of EGFR (epidermal growth factor receptor) in vitro; for these studies CaM was phosphorylated by c-Src (cellular sarcoma kinase).
26393498 Data suggest 17beta-estradiol stimulates odontoblastic differentiation of dental pulp via coordinated regulation of estrogen receptor alpha, c-Src, and MAP kinase signaling pathways, which may play key role in calcification/regeneration of dentin.
26358373 Data show that src kinases (SRC) and mitogen-activated protein kinase kinase 1 (MEK) co-inhibition by saracatinib and PD0325901 respectively can be broadly effective in tumor growth control of a wide panel of non-small cell lung cancer (NSCLC) cell lines.
26325669 Data suggest that Src kinases inhibitors may act with different mechanisms in non-small cell lung cancer (NSCLC) depending on EGF receptor (EGFR)/Ras protein (Ras) mutational profile.
26296907 Data show that c-Src is expressed by Sertoli and germ cells; its activation is required for germ cell adhesion and detachment and it mediates disassembly of Sertoli cell-spermatid junctions during spermatogenesis through an endocytic mechanism.[review]
26261043 our integrative approach enabled the discovery of a new model where Src is de-activated in coordination with membrane protrusion, providing important insights into the regulation of endothelial migration and angiogenesis.
26258764 Data reveal that introducing mutations in SH3 domain results in reduced Src motility at the cell membrane, both inside and outside of focal adhesions.
26252487 ligand binding to cell surface GD2 induces rapid and transient activation of Src-family kinases, followed by Src-dependent phosphorylation of NMDA-receptor NR2B subunits selectively.
26205662 Src-mediated Y724 phosphorylation in ELMO1 plays a critical role for cell spreading via activation of Rac1, leading to promotion of cell migration.
26200837 Src expression showed a significantly positive linear relationship with RANK, suggesting a potential mechanism of the RANKL-RANK axis in regulating breast cancer cell differentiation and antiapoptosis.
26198631 Data show that YY1 transcription factor (YY1) is tyrosine-phosphorylated by Src family kinases, leading to down-regulation of its activity.
26173590 these results indicate that in HCFs, activation of NF-kappaB by c-Src-mediated transactivation of EGFR/PI3K/Akt cascade is required for TNF-alpha-induced VCAM-1 expression.
26082485 Our results demonstrate that SRC-1 promotes HCC progression by enhancing Wnt/b-catenin signaling and suggest that SRC-1 is a potential therapeutic molecular target for HCC.
26041409 activation of Src/STAT3/HO-1/autophagy signaling pathway might play a general role in protecting certain subtypes of breast cancer cells from doxorubicin-induced cytotoxicity
26037143 findings suggest that Src, Kindlin-2 and Migfilin together constitute a positive feedback loop that controls Src activity and regulates integrin-mediated cellular func
26032498 SPON1 promotes metastatic progression through Fak and Src dependent pathway in human osteosarcoma.
26011449 This study provides an additional mechanistic link between Angiotensin II and vasoconstriction via SFK-enhanced MLC phosphorylation in smooth muscle cells.
25982272 In marked contrast to invadopodia, this degradation does not require the action of Src kinase, Cdc42 or Dyn2. Rather, inhibition of Dyn2 causes a marked upregulation of stromal matrix degradation
25979842 these results indicate that biological changes induced by CD44 silencing are mediated by cumulative down-regulation of c-Jun, Sp1, and c-Src in human breast cancer cells.
25961473 These data demonstrate that the p52Shc phosphorylation level is altered by the solution environment without affecting the fraction of active c-Src.
25958313 Cell surface GRP78 directly binds and phosphorylates c-Src. As a consequence, c-Src phosphorylated EGFR, promoting the invasion and metastasis of HCCs.
25948553 Thus, Src inhibitors emerge as a new class of drugs able to promote frataxin accumulation, suggesting their possible use as therapeutics in Friedreich's Ataxia
25947380 the primary interaction of c-Src with the beta3 tail occurs in its activated state and at a site that overlaps with PPII binding site in its SH3 domain.
25922567 Src, Syk, IRAK1, and IRAK4 have roles in anti-inflammatory responses mediated by dietary flavonoid Kaempferol
25921464 carbon monoxide-releasing molecule-2-induced heme oxygenase-1 protein and mRNA levels were inhibited by the inhibitor of c-Src
25914053 Results highlight the scaffolding role of the SH3 domain for the c-Src N-terminal intrinsically disordered regions and suggest a connection between the regulatory mechanisms involving the SH3 and Unique domains.
25897081 PTP1B inhibited BRK by dephosphorylating Tyr-342, but activated SRC by antagonizing PAG-dependent inhibition by CSK.
25867068 Fer interacted with active c-Src at focal adhesion membranes. Fer tyrosine kinase oligomer mediates and amplifies Src-induced tumor progression.
25820822 We conclude that AFB1 may upregulate IRS2 and stimulate lung cancer cell migration through Src
25805816 WNK4 is a substrate of SFKs and the association of c-Src and PTP-1D with WNK4 at Tyr(1092) and Tyr(1143) plays an important role in modulating the inhibitory effect of WNK4 on ROMK
25802280 The existence of an AR-miR-1-SRC regulatory network.
25802190 c-Src signaling modulates osteoblast differentiation at least in part through phosphorylation of Osterix.
25730905 prostate cancer cell invasion is stimulated by a rapid but sustained increase in Src activity, mediated non-genomically by cytoplasmic AR, leading to rapid activation and shedding of the laminin protease Matriptase
25725252 Src and p-Src can be used as an auxiliary indicator to determine a malignant phenotype of bone tumors, and the combined detection of Src and p-Src may indicate the prognosis of osteosarcoma.
25711159 performed immunohistochemical staining for total and phosphorylated forms of FAK and Src, to evaluate the role of FAK and Src in the development of premalignant and malignant skin lesions
25635050 A novel mechanism of regulation of NMHC-IIA activity relying on the phosphorylation of Tyr-158 by Src.
25585026 TGF-beta activates Src in H358 cells largely through a non-canonical redox mechanism.
25569182 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
25554601 These findings provide a new insight into VEGF and c-Src mode of reaction in triggering destructive repair of osteonecrosis.
25533622 Radiation exposure activates SRC induced SLUG expression and causes epithelial-mesenchymal cell transition through phosphatidylinositol 3-kinase/protein kinase B and p38 MAPK signaling.
25523213 EspJ inhibits autophosphorylation of host Src and phosphorylation of the Src substrates Tir and FcgammaRIIa.
25517315 Data indicate that CD20 antigen downregulation relies on transcriptional mechanisms in SRC family kinases (SFKs)-dependent transcriptional regulation of CD20.
25501895 reactive oxygen species (ROS) trigger the c-Src kinase-mediated tyrosine (Tyr)-195 phosphorylation of PKP3.
25477471 role for beta1-integrin in stretch-induced renal fibrosis through the activation of c-Src and STAT3 signaling pathways
25452256 FVB murine prostate epithelium was transduced with oncogenic v-Src.
25428919 CD147 has a role in promoting Src-dependent activation of Rac1 signaling through STAT3/DOCK8 during the motility of hepatocellular carcinoma cells
25392346 Results indicate that oncogenic Src may contribute to Fn14 overexpression in solid tumors, and that Src mediated cell invasion could potentially be inhibited with Fn14- targeted therapeutics.
25362852 Findings suggest that polyomavirus middle T-antigen (PyMT) activates the Hippo pathway tumor suppressor Lats in a Src-dependent manner.
25359883 Eps8 is a crucial mediator of Src- and FAK-regulated processes.
25350844 These results indicate that pathologic activation of Src is a potential mechanism of acquired resistance to ERBB2 inhibition in ERBB2-amplified gastroesophageal cancer.
25301365 Membrane AR activation regulates late expression and/or activity of the tumorigenic gene products c-Src, GSK-3beta. and beta-catenin
25287652 The absence of MIM led to PTPdelta-mediated activation of SRC.
25237194 kindlin-2 tyrosine phosphorylation and interaction with Src serve as a regulatable switch downstream of focal adhesion kinase in the integrin outside-in signaling circuit controlling cell migration and proliferation
25201048 These results demonstrated that S1P-induced COX-2 expression and PGE2 /IL-6 generation was mediated through S1PR1/3/c-Src/PYK2/p42/p44 MAPK- or JNK1/2- and S1PR1/3/c-Src/p38 MAPK-dependent AP-1 activation.
25197973 Since Ruxolitinib is a relatively small inhibitor and there is sizeable cavity between Ruxolitinib and c-Src ligand-binding pocket, we propose to modify Ruxolitinib to develop more potent inhibitors to c-Src
25195599 miR-1280 is a tumor suppressor in melanoma via inhibition of the Src signaling pathway.
25193862 these findings reveal a novel role for Src/FAK pathway kinases in antineoplastic drug resistance
25187556 HIF-1 and HIF-2 directly activate the expression of AXL and GAS6/AXL signaling uses lateral activation of the met proto-oncogene (MET) through SRC proto-oncogene nonreceptor tyrosine kinase to maximize cellular invasion.
25181017 Compound K inhibits TNF-alpha-induced MMP-1 expression through the inactivation of c-Src/EGFR-dependent ERK/AP-1 signalling pathway, resulting in the inhibition of collagen degradation in human fibroblast cells
25164009 HER2-positive breast cancers from patients who received trastuzumab exhibited a positive correlation in d16HER2 and pSRC abundance, consistent with the mouse genetic results.
25157407 Fluid flow reduced cytokine-induced SRC activities in the plasma membrane, but not in the cytosol.
25157176 Ras-tyrosine 32 serves as an Src-dependent keystone regulatory residue that modulates Ras GTPase activity and ensures unidirectionality to the Ras GTPase cycle.
25116152 The interaction of different CagA variants with the kinase Src, was investigated.
25084697 Cbl negatively regulates EPO signaling mainly through the proteasome-dependent degradation of Src, and the E3 ligase activity of Cbl and its tyrosine phosphorylation are regulated by Src but not Jak2.
25074934 over time with physiological levels of receptor phosphorylation, cell surface receptors produced either enhanced or sustained mitogen-activated protein kinase kinase (MEK), Casitas B-lineage lymphoma (c-Cbl), and the pro-oncogene Src activity.
25070888 Collectively, these findings establish Src and pro-angiogenic mitogens as critical mediators of endoglin stability and function
25028927 SRC is a putative diagnostic marker to differentiate Undifferentiated Pleomorphic Sarcoma from high-grade Leiomyosarcoma
24983503 a critical role of flotillin-1 in ROS production mediated by c-Src
24971543 These data suggest that v-Src attenuates ATR-Chk1 signaling through the inhibition of Rad17-Rad9 interaction.
24967003 PELP1 exhibits an oncogenic function in colorectal cancer through c-Src upregulation.
24937674 Src activation participates in trastuzumab mechanisms of resistance and indicates poor prognosis in breast cancer.
24903382 Data indicate that Src kinase participates in the regulation of apoptosis through Src/PI-3 K/Akt signaling pathway in Hep-2 cell line.
24887236 Src activation in lapatinib-resistant cells depends on EGFR-dependent rather than on HER2-dependent signaling.
24863135 Activation of c-Src kinase in tubular epithelial cells induces epithelial-mesenchymal transition through autophagy.
24840271 Data suggest that Src activates EGFR through the interaction of both Src-EGFR and Src-caveolin-1, and then antagonizes TRAIL-induced apoptosis in gastric cancer cells.
24824657 We demonstrated that the association and oxidation of c-Src and SHP-1 by ROS are key steps in enhancing OC survival, which are responsible for increased bone loss when ovarian function ceases.
24722904 This study demonstrates that cyclic stretch disrupts tight junctions and adherens junctions by a JNK2, c-Src, and MLCK-dependent mechanism.
24714091 MET inhibitor or SRC inhibitor suppressed phosphorylation of MET and SRC. These results implicate alternative targeting of MET or SRC as rational strategies for reversing cetuximab resistance in colon cancer.
24708996 c-Src-mediated signal positively regulates ACER activity in a Ca2+-independent manner.
24666322 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
24644285 the role of EMP2 in the pathogenesis of GBM a
24634213 Data indicate that inhibition of Src activity induces persistent activation of ataxia telangiectasia mutated (ATM)- and Rad3-related (ATR) and check point kinase 1 (Chk1).
24587194 hERG and hEAG channels are regulated by Src and by SHP-1 tyrosine phosphatase via an ITIM region in the cyclic nucleotide binding domain.
24481818 MICAL-L1-mediated recruitment of EHD1 to Src-containing recycling endosomes is required for the release of Src from the perinuclear endocytic recycling compartment in response to growth factor stimulation.
24469069 CXCL4 and CXCL4L1 activated p38 MAPK, as well as Src kinase within 30 and 5 min, respectively. Extracellular signal-regulated kinase (ERK) phosphorylation occurred in activated lymphocytes.
24457967 Cx43 regulates c-Src activity and proliferation in human glioma stem cell.
24440771 Src-mediated ERK reactivation may play a role in a novel gefitinib resistance mechanism in non small cell lung cancer.
24413044 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
24413044 Knockdown of c-SRC tyrosine kinase by siRNA enhances HIV-1 infectivity in Jurkat cells
24407236 Phosphorylate caspase-7 bu Src at multiple tyrosine sites enhanced its cellular apoptotic effect.
24403252 Src controls castration recurrence of CWR22 prostate cancer xenografts.
24390736 Bufalin as a potent small-molecule inhibitor for SRC-3 and SRC-1.
24369899 These data demonstrate that activating the Akt/mTOR cascade and inducing PLK-1 or Twist-1 by c-Src activity depends on the direct interaction between TrkA and c-Src.
24328683 Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of PKP3 and its detachment from DSG3.
24296779 Src kinase mediates the phosphorylation and activation of cortactin induced by MPZL1 overexpression.
24239173 Data indicate that verapamil suppresses MDR1 and survivin expressions and increases Bim expression via suppression of Src activation.
24200972 our results demonstrate that breast cancer cells with acquired resistance to lapatinib have a more aggressive phenotype compared with their parental counterpart, and that Src signaling and CXCR4 play an important role in this phenomenon.
24196445 our results suggest that Src kinase suppresses the apoptotic p53 pathway by phosphorylating HIPK2 and relocalizing the kinase to the cytoplasm.
24183378 Data indicate the role of the c-Src inhibitor to block E2-induced apoptosis and enhance E2-stimulated growth.
24151076 This study uncovers a novel mechanism where a phosphoinositide-synthesizing enzyme, PIPKIgammai2, functions with the proto-oncogene Src, to regulate oncogenic signaling.
24142406 Pyk2 and Src are important in CCL18-induced breast cancer metastasis.
24136222 Together with HK II and Src, mitochondrial DMPK is part of a multimolecular complex endowed with antioxidant and pro-survival properties.
24126923 ARHGEF5/Src can be considered as a prognostic biomarker and a therapeutic target for patients with resected non-small cell lung cancer .
24123009 Confluence of cultured lung cancer cells dramatically increases STAT3 activation independent of SRC action.
24120917 DHA not only displaced several raft-associated onco-proteins, including EGFR, Hsp90, Akt, and Src, from the rafts but also decreased total levels of those proteins via multiple pathways, including the proteasomal and lysosomal pathways
24108181 We hypothesize a potential direct or indirect role for SRC, RAF1, PTK2B genes in neurotransmission and in central nervous system signaling processes.
24100030 a novel mechanism by which the interaction between PP2A and Src in the context of caspase-8 activation modulates TRAIL sensitivity in cancer cells.
24069415 c-Src and NWASP play key roles in mediating the molecular pathogenesis of low oxygen-induced accelerated brain invasion by gliomas.
24058594 NEDD9 promotes migration and invasion in cervical carcinoma cells, probably via a positive feedback loop of tyrosine phosphorylation between NEDD9 and FAK or SRC.
24037722 Expression of COX-2 and Src correlated significantly with survival in patients with gastric cancer.
24007880 Src is an inducer of ADAM28 gene expression through the MEK/extracellular signal-regulated kinase and PI3K/mammalian target of rapamycin pathways.
23991004 Data indicate that luteolin and quercetin attenuate the phosphorylation of cortactin and Src, disruption of invadopodia generation suppression of matrix metalloproteinase MMP9 secretion, and reduction in metastasis.
23955631 Spry4 overexpression resulted in decreased integrin beta3 protein levels in a post-transcriptional manner in part by modulating its tyrosine phosphorylation by c-Src
23949219 MBNL142-43 bind the Src-homology 3 domain of Src family kinases (SFKs) via their proline-rich motifs.
23940647 A potential novel mechanism of c-src activation in plasma cell dyscrasia.
23920124 Data indicate that the anti-tumor effects of guggulsterone (GS) possibly involve multiple networks including inhibition of FAK, Src, and Jak/STAT signaling.
23913837 Results show a constitutive interaction between Src kinase and beta3 integrin through its SH3 domain and the phosphorylation of tyrosine in beta3 prevents this interaction.
23913825 High SRC expression is associated with breast cancer brain metastases.
23882690 Active PKCalpha phosphorylates Src to induce PI-3K to phosphorylate AKT that subsequently activates the ERK1/2 cascade to stimulate goblet cell proliferation.
23873931 SFK stimulates the basolateral K channel activity in DCT1, at least partially, by phosphorylating Tyr(9) on KCNJ10
23804646 c-Src dramatically stimulates IRF4 phosphorylation and activity and Y61 and Y124 are two key sites responding to c-Src-mediated activation. Consistently, c-Src is constitutively expressed and active in EBV-transformed cells.
23790975 The posttranscriptional regulation of Src contributes to the deregulated cell growth and metastasis in gastric cancer.
23751956 Data show Src-inducible association of CrkL with procaspase-8 promotes cell migration.
23726918 Data suggest a treatment rationale for Src- or Ras-activated cancer.
23707526 c-SRC kinase interacts with FLT3 and c-Kit in a phosphorylation dependent manner. This interaction is facilitated through the SH2-domain of c-SRC kinase.
23703528 study showed that PLC-gamma directly binds c-Src through its SH2 domains, and this interaction is necessary for CCh mediated inhibition of NHE3 activity in Caco-2/BBe/NHE3 cells.
23696930 Phospho-Src expression may be considered as a prognostic marker to predict recurrence in cervical squamous cell carcinoma.
23651497 The H2O2-induced src/PDGFRbeta/SK1 signaling cascade was impaired in nSMase2-deficient fro/fro cells and was rescued by exogenous C2Cer that activated src/PDGFRbeta/SK1.
23644655 Data show that macrophages on gastric and colorectal cancer cells migration through epidermal growth factor receptor and phosphorylation of Akt, c-Src and ERK1/2, and led to an increase of RhoA and Cdc42 activity.
23640056 Data indicate that tissue transglutaminase (TG2) regulates beta-catenin expression and function in ovarian cancer (OC) cells and define the c-Src-dependent mechanism through which this occurs.
23615537 results suggest that c-Src suppression by PP2 or siRNAs may regulate the progression of cell cycle through AKT/GSK3beta and ERK1/2 pathways
23585863 Src may play a major role in regulating ING1 levels during tumorigenesis in those cancers in which high levels of Src expression or activity are present.
23563312 HIF1alpha and HIF2alpha activate independent transcriptional programs through SRC that promote metastasis by coordinately regulating cell invasion and ECM remodeling
23562843 v-Src inhibits cell proliferation of HCT116 and HeLa S3 cells.
23536784 Src controls invasion by controlling the ability of the cell to form long lasting cellular protrusions to enable penetration through tissue barriers, in addition to its role in promoting invadopodia matrix-degrading activity.
23532252 results suggested that PTPalpha links activation of epidermal growth factor receptor (EGFR) signaling with Src activation and may provide a novel therapeutic target for treatment of breast cancer.
23500080 Oroxylin A sensitized anoikis, which underlies distinct glucose-deprivation-like mechanisms that involved c-Src and HK II.
23497302 Expression of HPV type 16 E7 resulted in increase in Src and Yes proteins level, but did not alter the level of Fyn.
23400779 a truncated fragment of Src protein kinase generated by calpain-mediated cleavage is a mediator of neuronal death in excitotoxicity
23380740 Natural killer cell lytic granule convergence, prompted by specific receptor-mediated and soluble cytokine signals, depends on a directly downstream early Src kinase-dependent signal.
23360994 Src is identified as a key regulator of phosphoproteomic signalling networks activated in response to beta-adrenergic signalling in cancer cells.
23349873 DUOX1 plays a central role in epithelial defense responses to infection or injury, by mediating oxidative activation of Src and ADAM17 in response to ATP-dependent P2Y(2)R activation as a proximal step in EGFR transactivation and downstream signaling.
23341451 fucoidan is a novel CLEC-2 receptor agonist that activates platelets through a SFK-dependent signaling pathway
23338526 the present study demonstrated that Src plays a biologically significant role in tumor proliferation and apoptosis and enhances the cytotoxic effect of temozolomide through AKT supression in glioma.
23292187 Data indicate protein secretion pathways activated by monosodium urate (MSU) in macrophages, and reveal a novel role for cathepsin B and Src, Pyk2, PI3 kinases in the activation of unconventional protein secretion.
23291984 Brk/PTK6 cooperates with HER2 and Src in regulating breast cancer cell survival and epithelial-to-mesenchymal transition.
23281368 Src family kinases could play a pivotal role in increasing B cell receptor sensitivity to monomeric antigens and in mediating a rapid response to soluble multimeric antigens of pathogens that can induce spatial BCR clustering.
23277333 activation of c-Src protein through phosphorylation at Tyr416 may play a role in the early stages of ovarian cancer development
23271399 Data suggest that the antitumor effects of Src inhibition in pancreatic cancer may be enhanced through simultaneous inhibition of SHP-2.
23242808 Data indicate that BRAF and EGF receptor or SRC family kinase inhibition blocked proliferation and invasion of the resistant tumors.
23209645 Rap1 can induce cell adhesion and stimulate an accelerated rate of cell spreading through mechanisms that bypass the canonical FAK-Src-Paxillin signalling cascade
23179791 Data indicate that focal adhesion kinase (FAK) activation and cell migration require Src, Gi/Go, COX-2 and LOXs activities.
23178654 These results suggest that folic acid might inhibit endothelial cell migration through inhibiting the RhoA activity mediated by activating the FR/cSrc/p190RhoGAP-signaling pathway.
23119100 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
23119029 in human colon cancer cells Src-mediated cross-talk between FXR and EGFR modulates ERK phosphorylation, thereby regulating intestinal cell proliferation and tumorigenesis.
23066026 Src family kinases, PI3 kinase and protein kinase C synergize to mediate Gq-dependent platelet activation
22957062 Knocking down low molecular weight protein tyrosine phosphatase (LMW-PTP) reverts chemoresistance through inactivation of Src and Bcr-Abl proteins
22957061 AnxA2 has a role in EGFR-Src membrane bound signaling complex and ligand induced activation of downstream signaling pathways
22927910 Src functions as a switch of EGF signaling depending on concentrations of EGF
22880054 The Epstein-Barr virus protein LMP1, which lacks the canonical ITAM required for Syk activation, can nevertheless activate Syk, and the Src kinase Fyn, resulting in downstream c-Cbl and PI3K/Akt activation.
22865929 ERalpha phosphorylation at Y537 by Src triggers E6-AP-ERalpha binding, ERalpha ubiquitylation, promoter occupancy, and target gene expression.
22833562 Data show that EGFR activation leads to a pronounced src-mediated tyrosine phosphorylation of CIN85 that subsequently influences EGFR ubiquitination.
22810232 Involvement of c-Src tyrosine kinase upstream of class I phosphatidylinositol (PI) 3-kinases in Salmonella Enteritidis Rck protein-mediated invasion.
22768099 A cooperative interplay between FAK, Src and cortactin enables endocytosis of N. meningitidis into host cells.
22760497 results provide evidence that CD24 regulates STAT3 and FAK activity and suggest an important role of Src in this process
22716210 c-Src expression is a potential independent predictor of poor prognosis in breast cancer patients with bone metastasis.
22689581 c-Src but not Fyn promotes proper spindle orientation in early prometaphase
22675553 The interaction between HGF and c-Met increases OPN expression in human osteoblasts via the PI3K, Akt, c-Src, c-Jun, and AP-1 signaling pathway.
22660634 A previously unidentified 70-kDa SRC-1 proteolytic isoform is highly elevated both in the endometriotic tissue of mice with endometriosis and in endometriotic stromal cells biopsied from patients with endometriosis.
22658320 c-Src has an essential role in mediating the growth pathways of ER-negative breast cancer cells. It controls estrogen action in ER-positive long-term estrogen-deprived resistant cells.
22653778 Bradykinin enhances cell migration in human prostate cancer cells through B2 receptor/PKC delta/c-Src dependent signaling pathway.
22591684 Src, Akt, NF-kappaB, BCL-2 and c-IAP1 may be involved in an anti-apoptotic effect in patients with BCR-ABL positive and BCR-ABL negative acute lymphoblastic leukemia.
22586492 EGFR and Src activity contribute to carcinoma cell invasion and metastasis mediated by integrin alphavbeta5 in part by promoting proteolytic cleavage of MUC1 .
22577255 analysis of Syk/Src pathway-targeted inhibition of skin inflammatory responses by carnosic acid
22577141 activation of alpha7 by ZP leads to SFK-dependent EGFR activation, Ca(2+) influx, and the acrosome reaction
22532564 Data indicates that 2B15 requires regulated phosphorylation by both PKCalpha and Src, which is consistent with the complexity of synthesis and metabolism of its major substrate, DHT.
22508042 Src-mediated caspase-8 phosphorylation stimulates Src phosphorylation at Tyr-416 via the linkage of Src SH2 domain with phosph-Tyr-380 site of caspase-8.
22488171 Data indicate a potential role of focal adhesion kinase (FAK) and Src signaling in mobile tongue squamous cell carcinoma (SCC), rendering their small-molecule tyrosine kinase inhibitors as possible treatment strategy in tongue cancer chemoprevention.
22479394 Data show that the Notch-1-Furin interaction is regulated by the non-receptor tyrosine kinase, c-Src.
22422068 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
22414081 Studies indicate Src family of protein tyrosine kinases (SFKs) lead to uncontrolled cell proliferation and cancers, and Src kinase inhibitors were developed to block cell proliferation signal transductions for cancer therapy.
22402981 Integrin b1/Fak/Src-mediated regulation of cell survival and anoikis in human intestinal epithelial cells.
22393415 the activation of Hck, Lyn and c-Src by Nef is highly conserved among all major clades of HIV-1
22388352 Src tyrosine kinase inhibits apoptosis through the Erk1/2- dependent degradation of the death accelerator Bik.
22383989 SRC, c-MET and CRK play a key role in gastric carcinogenesis by modulating CagA signal transductions and interaction between CRK gene and phytoestrogens modify gastric cancer risk
22378042 c-Src only phosphorylated H. pylori EPIYA-C and EPIYA-D.
22362758 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
22361730 These data support novel observations that, in human colon cancer cells, Src-mediated cross talk between aryl hydrocarbon and EGFR results in ERK1/2 activation, thereby stimulating cell proliferation.
22354875 A selective SFK inhibitor inhibited Src family kinase activity.
22353809 activation of the Src family members and downstream signalling proteins are associated with a good prognosis in transitional cell carcinoma of the bladder, and activated Src has a positive relationship with RhoGD12.
22328516 In NEDD9-overexpressing melanoma cells, inhibition of Src with dasatinib results in a switch from Rac-driven elongated, mesenchymal-type invasion to ROCK-dependent rounded, amoeboid invasion
22323579 EGFRvIII (also known as DeltaEGFR and de2-7EGFR), a constitutively active EGFR mutant that is frequently co-overexpressed with EGFR in human glioblastoma, promotes tumorigenesis through Src family kinase (SFK)-dependent phosphorylation of Dock180.
22321370 Src kinase inhibition led to a decrease in mitochondrial respiration via a specific decrease in complex I activities which is associated with a lower phosphorylation of the complex I subunit NDUFB10.
22310287 combined inhibition of MEK and SRC is a promising approach to improve the efficacy of targeting the ERK/MAP kinase pathway in melanoma
22279592 Data show that EphrinB1, a PTPN13 substrate, interacts with ErbB2, and Src kinase mediates EphrinB1 phosphorylation and subsequent MAP Kinase signaling.
22252554 c-Src and IL-6 inhibit osteoblast differentiation and integrate IGFBP5 signalling
22247553 Fibronectin induces endothelial cell migration through beta1 integrin and Src-dependent phosphorylation of fibroblast growth factor receptor-1 at tyrosines 653/654 and 766.
22241990 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
22238675 Trihydrophobin 1 phosphorylation by c-Src regulates MAPK/ERK signaling and cell migration.
22203239 K562 exosomes induced dasatinib-sensitive Src phosphorylation and activation of downstream Src pathway proteins in human umbilical endothelial cells.
22200682 The effect of gemcitabine-induced cytotoxicity was markedly increased in the psiRNA-c-Src group (P<0.05).
22134837 Lymph node positivity correlated with cytoplasmic c-Src tumour expression levels (P < 0.001).
22110760 human PDZ-cellular ligands of NS1 protein
22105363 c-Src is capable of phosphorylating tyr residues of c-Fos whereas the phosphatase TC45 T-cell protein-tyr phosphatase (TC-PTP) dephosphorylates them
22052839 The expression of Src protein is significantly associated with the progression, recurrence, and prognosis of oral squamous cell carcinoma in Taiwan.
22037769 Src kinase activity downregulates C/EBP-delta protein but not mRNA levels through a SIAH2 E3 ligase-dependent mechanism.
21994943 analysis of cellular settings mediating Src Substrate switching between focal adhesion kinase tyrosine 861 and CUB-domain-containing protein 1 (CDCP1) tyrosine 734
21994334 Findings suggest that large HBsAg (LHBs) promotes tumorigenesis of hepatoma cells by triggering a PKCalpha/Raf1 to Src/PI3K/Akt signaling pathway, revealing novel insights into the underlying mechanisms of HBV-associated hepatocarcinogenesis.
21984372 results provide evidence that CD24 can regulate cell invasion via TFPI-2 and suggests a role of c-Src in this process
21961241 The expression of SRC-1 is correlated with the growth of LNCap cells; its high expression in androgen-independent prostate cancer cells may be involved in the progression to androgen-independence.
21953458 Express path analysis identifies a tyrosine kinase Src-centric network regulating divergent host responses to Mycobacterium tuberculosis infection.
21892329 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
21875461 Cell surface HSP90 promotes human prostate cancer cell invasion through FAK/c-Src signaling.
21859709 TfR1 is a signaling molecule and tyrosine phosphorylation at position 20 by Src enhances anti-apoptosis and potentiates breast cancer cell survival.
21856747 Ligand-dependent corepressor acts as a novel androgen receptor corepressor, inhibits prostate cancer growth, and is functionally inactivated by the Src protein kinase.
21840312 These data suggest Src-stimulated IRTKS phosphorylation is essential for its function in cell motility.
21798038 Non-cysteine linked MUC1 cytoplasmic dimers are required for Src recruitment and ICAM-1 binding induced cell invasion.
21757754 the nongenomic PI3K signaling pathway plays a role in estrogen/hERalpha-stimulated hSlo1 gene expression; whereas c-Src activity leads to hSlo1 gene tonic repression independently of estrogen, likely through ERK activation.
21757638 We propose paxillin as a novel cellular target for converging H. pylori-induced EGFR, FAK/Src, and PI3K/Akt signaling to regulate cytoskeletal reorganization and IL-8 production in part, thus contributing to the H. pylori-induced diseases.
21741415 c-Src might be suggested as a bio-marker predicting metastasis sensitivity patterns to HDAC inhibitors.
21737505 Data suggest that targeting Src kinase with a combination of dasatinib and oxaliplatin may be an attractive approach for mucinous ovarian carcinoma.
21725358 Data show that the signaling events that accompany the CDCP1 tyrosine phosphorylation observed in cell lines and lung tumors may explain how the CDCP1/SFK complex regulates motility and adhesion.
21725282 The transformed cells were tumourigenic in nude mice, suggesting that RPTPalpha245-induced activation of Src in the human tumours may have contributed to carcinogenesis.
21725161 the active state of c-Src, p-Tyr416-c-Src, may serve as an independent prognostic marker of patient survival in hepatocellular carcinoma
21716326 Suppression of E-cadherin function drives the early stages of Ras-induced squamous cell carcinoma through upregulation of FAK and Src.
21710320 c-src is a CD24-activated mediator that promotes integrin-mediated adhesion and invasion, and suggest a mechanism by which CD24 might contribute to tumor progression
21703394 Down-regulation of src is associated with autism.
21681336 The inhibited viability of HeLa cells caused by knockdown of c-SRC is associated with the decreased content of p-STAT3 protein.
21646863 Studies indicate that administration of SFK inhibitors in combination with paclitaxel could improve treatment for cancers.
21637765 Manipulation of EMP2 levels in endometrial cancer cells regulates the phosphorylation of FAK and Src, and promotes their distribution into lipid raft domains.
21632985 Results suggest that a HIF-regulated VHL-PTP1B-Src signaling pathway determines the sensitivity of RCC to Src inhibitors.
21618517 Data suggest that thymidylate synthase (TS) and Src may belong to a common pathway that bears prognostic significance in NSCLC, and that Src represents a potential target to improve the efficacy of TS-inhibiting agents.
21613217 an essential role of calmodulin in mediating Fas-induced FADD-independent activation of Src-ERK signaling pathways, which promote survival signaling in pancreatic cancer cells.
21573184 Evidence is presented for the nuclear presence of a functional heteromeric complex of epidermal growth factor (EGFR), Src and the Signal Transducer and Activator of Transcription (Stat)3 proteins in pancreatic cancer cells.
21541295 These findings demonstrate the effectiveness of simultaneous targeting of Src and the downstream signaling partners Stat3 and/or cMyc to inhibit the growth and oncogenic properties of a human cancer cell line.
21536681 cPLA(2)-dependent AA release is required for VEGF-induced Src-PLD1-PKCgamma-mediated pathological retinal angiogenesis
21509526 Combination of Src kinase inhibitor KX-01 with tamoxifen may present a promising new strategy for clinical management of ERalpha positive breast cancer.
21508333 c-Src inactivation via SKI-606 reduces renal epithelial cell-matrix adhesion, proliferation, and cyst formation in autosomal dominant polycystic kidney disease.
21496428 Phosphorylation of Src, but not over-expression, plays a pivotal role in proliferation and invasion of NSCLC cell lines in vitro.
21496277 transactivation of c-Met on Axl or PDGFR-alpha in vitro was through a ras- and Src-independent activation of mitogen-activated protein kinase/extracellular signal-regulated kinase (MEK/ERK) pathway
21490433 Src-Trask signaling and Src-focal adhesion signaling inactivate each other, constituting two opposing modes of phosphotyrosine signaling that define a switch underlining cell anchorage state.
21490376 High expression of either Y416Src or Y527Src was significantly correlated with poor overall survival in breast cancer patients
21445970 Melanoma cells show remarkable resistance to Cav-1 disassembly, together with persisting cell signal activity, being Src and Cav-1 crucial modulators of Rho GTPases.
21445358 results provide new evidence that the activation of Src/Smad1 signaling pathway plays a key role in the development of glomerulosclerosis in experimental glomerulonephritis
21390316 c-Yes regulates specific oncogenic signalling pathways important for colon cancer progression that is not shared with c-Src.
21383697 Findings suggest that the miR-99a-mTOR/FGFR3 pathway is crucial for controlling tumor growth in a wide range of human cancers that harbor upregulation of the Src-related oncogenic pathways.
21343398 SRC-1 can promote breast cancer metastasis by directly enhancing ITGA5 expression
21309750 ACK1 is not autoinhibited but requires Src for activation.
21301049 activates Abl to augment Robo1 expression in order to promote tumor cell migration
21300758 c-Src proto-oncogene tyrosine-protein kinase plays a biologically significant role in ovarian cancer growth and might represent an important target
21291860 p130Cas, Src and talin function in both oral carcinoma invasion and resistance to cisplatin.
21281808 TNC could induce EMT-like change showing loss of intercellular adhesion and enhanced migration in breast cancer cells, associated with FAK phosphorylation by SRC
21278788 findings suggest that TCTP induces tumorigenesis through distinct multicellular signaling pathways involving Src-dependent EGFR transactivation, ROS generation and MMP expression
21273440 Findings are consistent with the emerging role of proteasome-mediated proteolysis in the gene-regulating process and indicate that the ligand-dependent down-regulation of SRC-1 is critical for PR transcriptional activity.
21268077 Study observed that CREB was phosphorylated following transactivation of EGFR by c-Src in EV71-infected cells.
21257711 Our findings suggest a novel mechanism by which an EGFR-Src-Arg-cortactin pathway mediates functional maturation of invadopodia and breast cancer cell invasion
21248042 Collectively, these data provide evidence that Src kinase is an important mediator of signaling events that regulate the appropriate sorting of reovirus particles in the endocytic pathway for disassembly and cell entry.
21225226 Evidence for a role of Src in the regulation of basal proliferation as well as in basal and TGF-ss1-mediated cell motility but not epithelial-to-mesenchymal transition in TGF-ss-responsive pancreatic (tumor) cells.
21195420 activity in desmoid tumors variable
21177802 Small interfering RNA knockdown of Src within ANDV-infected endothelial cells resulted in decrease in endothelial cell permeability.
21169408 SHP-2 as an essential component of tumor suppression and anoikis mediated by SIRPalpha1 in human breast carcinoma cells as well as in v-Src-transformed cells.
21156787 Results indicate that Cbp is required for the Csk-mediated inactivation of c-Src and may control the promotion of malignancy in NSCLC tumors that are characterized by c-Src upregulation.
21151980 Dsg3, as an up-stream regulator of Src activity, helps regulate adherens junction formation through its interaction with E-cadherin
21062896 MT1-MMP regulates VEGF-A expression through a complex with VEGFR-2 and Src.
21062671 Denbinobin inhibits Src-mediated signaling pathways involved in controlling breast cancer migration and metastasis.
21058027 These results support an important potential role of FAK-Src signalling in endometrial malignant disease progress
21056984 UGT2B7 substrate selection is not fixed but varies depending upon the tyrosine kinases that carry out its required phosphorylation
21052789 Src pathway and EGFR pathway play different roles in the proliferation of cervical cancer cells and PP2 efficiently reduces cervical cancer cell proliferation by reduction of both Src and EGFR activity.
21045155 Data show E-cadherin molecular dynamics in vivo following perturbation of integrin signaling by inhibiting focal adhesion kinase (FAK) and Src.
21036157 These results suggest that heme actively interacts with Jak2 and Src and alters their conformation.
20959018 aldehyde dehydrogenase 1 has a role in the antitumor effect of the Src inhibitor dasatinib
20956943 c-Src differentially regulates the functions of microtentacles and invadopodia.
20943948 Src-mediated phosphorylation of Tyr110 on NoxA1 and of Tyr508 on Tks4 blocks their binding and decreases Nox1-dependent reactive oxygen species generation and induces the formation of functional invadopodia.
20871631 Data indicate that that a constitutively active transforming form of Src, the E378G mutant, as well as v-Src enhance ADAM17-mediated shedding of the EGFR ligand TGFalpha.
20829350 Data illustrate the importance of a coordinated signaling between Src PTKs, ERK1/2, and JNK during pIgR-mediated uptake of pneumococci by host epithelial cells.
20796316 c-Src was expressed in malignant melanoma, squamous cell carcinoma and basal cell carcinoma type skin neoplasms.
20705589 Data show that c-Src suppression by PP2 or siRNA reversed the mesenchymal-like phenotype in MDA-MB-231 cells.
20661303 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
20659428 microexons provide a mechanism for the control of tissue-specific interactions of ITSN1 and Src with their partners.
20615878 Cross-talk between serine/threonine protein phosphatase 2A and protein tyrosine phosphatase 1B regulates Src activation and adhesion of integrin alphaIIbbeta3 to fibrinogen.
20540746 study demonstrates, for the first time, that GCS upregulates MDR1 expression modulating drug resistance of cancer. GSLs, in particular globo series GSLs mediate gene expression of MDR1 through cSrc and beta-catenin signaling pathway
20460377 hPEBP4 inhibits proteasome-dependent ERalpha degradation through the Src pathway.
20452982 elevated Src family kinase activity is sufficient to induce imatinib resistance through a mechanism that may involve phosphorylation of Bcr-Abl
20448061 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
20431421 Data show that the FAK and Src immunohistochemical expression was associated with certain clinicopathological parameters that are crucial for the patients' management.
20405349 Present study aimed to evaluate by immunohistochemistry the clinical significance of FAK and Src expression in 108 patients with benign and malignant thyroid lesions.
20378826 Oxidative stress activates FAK and accelerates cell migration in an intestinal epithelium by a PI3 kinase- and Src kinase-dependent mechanism.
20371672 The data suggest an important role of Src/PKG-Ialpha interaction in promoting DNA synthesis/cell proliferation in human ovarian cancer cells.
20353998 Increased expression of PGE2 in the lung tumor microenvironment may initiate a mitogenic signaling cascade composed of EP4, betaArrestin1, and c-Src which mediates cancer cell migration.
20351107 c-Src modulation and ATF3 activity may contribute to differential regulation of IRF-3- versus IRF-5-mediated gene expression
20332114 Integrin alpha5 serves as a key mediator of Src and ErbB2-survival signaling in low adhesion states, which are necessary to block the pro-anoikis mediator Bim.
20176789 These data indicate that Src protein, along with other proteins, are important signal proteins that are responsible for the transfer of signals from activated integrins to the cytoskeleton and thus mediate the endocytosis of Neisseria meningitidis.
20155281 Reduced proliferative activity in endometriotic epithelia seems to be related to the reduced expression of SRC-1.
20152043 v-Src transformation has a role in aggressive tumor behavior in human cancer
20127031 Src induces expression of carbonic anhydrase IX via hypoxia-inducible factor 1.
20100835 tyrosine phosphorylation of RUNX3 by activated Src is associated with the cytoplasmic localization of RUNX3 in gastric and breast cancers
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20053757 15(S)-HETE-induced angiogenesis requires Src-mediated Egr-1-dependent rapid induction of FGF-2.
20028973 a novel regulatory mechanism of c-Src synthesis mediated by an IRES element, which exhibits enhanced activity during cellular stress and is likely to cause c-Src overexpression during oncogenesis and metastasis.
20013033 RhoGDI2 is associated with c-Src in bladder tumors, where the expression of both is diminished as a function of stage. c-Src binds to and phosphorylates RhoGDI2 resulting in enhanced metastasis suppressive potency. Review.
19965650 Thrombin-induced Src activation preceded JAK2 activation, which occurred simultaneously in normal and pathological platelets.
19956670 GD3 has a role in hypoxia susceptibility by disabling the c-Src/NF-kappaB survival pathway resulting in lower Mn-SOD expression
19948721 Results show that disruption of E-cadherin junctions and enhancement of cell invasion by beta-estradiol stimulation was mediated by NO-dependent activation of c-Src.
19948031 The findings presented in this study show that mutant EGFRs undergo aberrant traffic into the endocytic recycling compartment which allows mutant EGFRs to engage in a preferential interaction with Src, a critical partner for EGFR-mediated oncogenesis.
19940159 the c-Src/Cas/BCAR3 signaling axis is a prominent regulator of c-Src activity, which in turn controls cell behaviors that lead to aggressive and invasive breast tumor phenotypes
19924282 Rac activation by mechanical forces is rapid, direct and does not depend on Src activation
19903481 These results demonstrated the involvement of Src and its interaction with PI3K in E. coli K1 invasion of human brain microvascular endothelial cells .
19892015 The protein-tyrosine kinase c-src control Jak2 activation in response to prolactin through a tyrosine kinase-independent mechanism.
19887442 Macroscopic currents from HEK 293 cells expressing murine BK channel alpha-subunits (mSlo) are acutely potentiated following alpha5beta1 integrin activation.
19881549 the phosphorylation of Gab1 by c-Src is important for hepatocyte growth factor -induced DNA synthesis
19878981 Study shows that transient activation of Src causes an epigenetic switch in which nontransformed MCF10A cells are converted into mammospheres that can be propagated for many generations in the absence of the initiating signal.
19875457 Phosphorylation of iNOS by Src plays an important role in the regulation of iNOS and nitric oxide production and hence could account for some Src-related roles in inflammation and cancer.
19861436 analysis of reciprocal regulation of c-Src and STAT3 in non-small cell lung cancer
19852943 Basal levels of active Src in colonic epithelial cells from patients with inflammatory bowel disease were markedly reduced compared to control patients.
19843640 Abl interactor 1 regulates Src-Id1-matrix metalloproteinase 9 axis and is required for invadopodia formation, extracellular matrix degradation and tumor growth of human breast cancer cells
19840943 CoxII can be phosphorylated by EGFR and c-Src, and EGF stimulation reduces Cox activity and cellular ATP, an event that is dependent in large part on EGFR localized to the mitochondria.
19833732 Migfilin interacts with Src and contributes to cell-matrix adhesion-mediated survival signaling
19822667 Results link Cdk5 to Rho-ROCK signaling via Src and p190RhoGAP and implicate Cdk5 in the regulation of cell contraction, attachment, and migration.
19808905 The mechanism by which alpha6beta4 enhances S100A4 expression involves Src, Akt, and NFAT.
19802004 Results suggest a novel mechanism by which cofilin is regulated by v-Src through tyrosine phosphorylation that triggers the degradation of cofilin through ubiquitination-proteosome pathway and reducing cellular F-actin contents and cell spreading.
19789182 These findings suggest roles for emerin as a downstream effector and signal integrator for tyrosine kinase signaling pathway(s) at the nuclear envelope.
19769962 Activated c-Src binds, phosphorylates, and redistributes ADAM12-L to specific sites at the cell periphery, which may in turn promote signalling mechanisms regulating cellular processes with importance in cancer.
19767770 RACK1, partly by inhibiting Src, promotes mitochondrial cell death and blocks Akt-mediated cell survival.
19762712 The aim of the current study was to assess the expression levels of c-Src and phosphorylated Src kinase in human breast cancers and to establish if these are linked to oestrogen receptor, progesterone receptor, and HER2 status or patient survival.
19755386 Role of Src kinase activity in adhesion and chemotaxis in Waldenstrom macroglobulinemia.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19718473 LASP-1 translocation to the cytoskeleton of activated platelets correlates with LASP-1 phosphorylation at tyrosine 171 by Src-kinase
19711372 pH 6.6 activates Src kinases, resulting in tyrosine phosphorylation of E-cadherin and p120ctn and a weakening of the association of E-cadherin with p120ctn and contributing to the instability of E-cadherin at adherens junctions
19703310 Data indicate that MetAP2 expression and pp60c-src phosphorylation were decreased in NC2213 treated cells.
19690143 a mechanism linking EGFR signaling with Fyn and Src activation to promote glioblastoma progression and invasion in vivo
19665017 MPP2 interacts with c-Src in cells to control c-Src activity and morphological function.
19620276 docking of the c-src SH2 domain to phosphorylated guanylyl cyclase C results in colocalization and further activation of c-src.
19546854 Proteins beta3 integrin, Vav3, Plekhm1, and Src, implicated in attachment defects, had normal exon sequences in a new type of osteopetrosis.
19540193 these results strongly suggest the importance of MSK1 and H3 phosphorylation in cell transformation by v-Src.
19535918 UNC80 functions as a scaffold for Src kinases in NALCN channel function.
19515834 Data show that overexpression of shrew-1 leads to preformation of an E-cadherin/EGF receptor/HER2/src-kinase/shrew-1 signaling complex and accelerated E-cadherin internalization.
19497848 PTPalpha acts as an adaptor to mediate functional links between focal adhesions and the endoplasmic reticulum that enable IL-1-induced Ca2+ signaling.
19487280 Insights into the mechanism of how a splice variant linked to clinical agressiveness in breast cancer causes increased activity of ADAM15B.
19481075 Direct binding of toxin A to Src, independent of any effect on protein tyrosine phosphatase or Rho glucosylation, inhibits Src kinase activity followed by FAK/paxillin inactivation
19479902 EGFR-mediated sustained activation of Src intestinal epithelial cancer cells confers anoikis resistance at least in part through a consequent sustenance of Fak-Src interactions and MEK/Erk activation
19457864 SFK and cortactin constitute an important signaling pathway that functionally links E-cadherin adhesion and the actin cytoskeleton
19453261 Observational study of gene-disease association. (HuGE Navigator)
19447874 Study showed that 28% of patients with AIPC exhibited an increase in SFK activity in prostate cancer tissue, these patients had significantly shorter overall survival, and activated SFK expression correlated with the presence of distant metastases.
19435911 Activation of ErbB2, but not ErbB1, increases PTP1B expression, and increased expression of PTP1B activates Src and induces a Src-dependent transformed phenotype.
19435802 Data reveal a multicomponent kinase signaling pathway downstream of integrin-matrix interactions and Cdc42 activation involving PKCepsilon, Src, Yes, Pak2, Pak4, B-Raf, C-Raf and ERK1/2 to control EC lumen formation in 3D collagen matrices.
19419966 c-Src enhances RIG-I-mediated signaling, acting at the level of TRAF3
19393585 AZD0530 inhibited tumor growth in 4/10 xenograft models tested and dynamically inhibited in vivo phosphorylation of Src substrates paxillin and FAK in both growth-inhibition-resistant and -sensitive xenografts
19329556 Diesel particle-induced transcriptional expression of p21 involves activation of EGFR, Src, and Stat3
19321744 phosphorylation by Src enhances RhoGDI2 metastasis suppression and loss of Src relieves metastasis suppression in tumor
19305428 mutant EGFR-Src interaction and cooperativity play critical roles in constitutive engagement of the downstream signaling pathways that allow NSCLC-associated EGFR mutants to mediate oncogenesis.
19302982 activated c-Src played a critical role in the HBx-induced epithelial-to-mesenchymal transition in hepatoma cells.
19265199 the signal transduction pathways mediated by c-Kit/D816V are markedly different from those activated by wild-type c-Kit and altered substrate specificity of c-Kit circumvents a need for Src family kinases in signaling of growth and survival
19262695 beta-arrestins and c-Src are implicated in the activation of Akt in response to ghrelin through the GHS-R1a
19262138 P-selectin cross-links PSGL-1 and enhances neutrophil adhesion to fibrinogen and ICAM-1 in a Src kinase-dependent, but GPCR-independent mechanism.
19258394 These results suggest that SFK trafficking is specified by the palmitoylation state in the SH4 domain.
19223541 Sustained Src inhibition results in signal transducer and activator of transcription 3 (STAT3) activation and cancer cell survival via altered Janus-activated kinase-STAT3 binding.
19199380 Increased PRL1 expression results in activation of Src and ERK1/2, which stimulates MMP2 and MMP9 production, leading to increased cell migration and invasion.
19176482 Presenilin 1 affects focal adhesion site formation and cell force generation via c-Src transcriptional and posttranslational regulation
19160018 Rho mediates various phenotypes of malignant transformation by Ras and Src through its effectors, ROCK and mDia [review]
19147496 S100B interacts with Src kinase, thereby stimulating the PI3K/Akt and PI3K/RhoA pathways.
19130504 Nef regulates the NADPH oxidase p47(phox)activity through the activation of the Src kinases and PI3K
19112177 HINT1 up-regulates cellular levels of p27(KIP1) by two mechanisms: 1) it inhibits its ubiquitylation by targeting the SCF(SKP2) ubiquitin ligase complex, and 2) it inhibits the phosphorylation of p27(KIP1) by Src via inhibiting Src expression.
19111446 Mechanical wounding induces significant ROS generation at the wound edge which, in turn, induced ligand-independent KGFR and FRS2 activation via c-Src kinase signaling.
19074832 the c-Src-Rac1-p38 MAPK pathway is required for activation of Akt in response to radiation and plays a cytoprotective role against radiation in human cancer cells
19066724 Data suggest that upon phosphorylation, Src is directly translocated from focal adhesions to membrane ruffles, thereby promoting formation of new adhesion complexes.
19048118 Src family kinases mediate betel quid-induced oral cancer cell motility
19047046 as a mediator of SF- and Src-stimulated NF-kappaB activity. Finally, the Src/Rac1/MKK3/6/p38 and Src/TAK1/NF-kappaB-inducing kinase pathways exhibited cross-talk at the level of MKK3.
19035465 KV11 peptide (from human Apolipoprotein A) suppresses angiogenesis and tumor progression by targeting the c-Src/ERK signaling pathways in VEGF induced cells
18948751 TCPTP is a negative regulator of SFK, JAK1 and STAT3 signalling during the cell cycle.
18924149 Src and Src-associated signaling pathways are activated in relation to hypoxia in neoplasms
18922903 Src and ADAM-17-mediated shedding of transforming growth factor-alpha is a mechanism of acute resistance to TRAIL.
18839319 Src overexpression downregulates alpha3 integrin total protein expression and localization to the cell surface of HCT116 colon cancer cells. This indicates that Src activity may enhance metastasis by altering alpha3 integrin expression.
18832467 data are compatible with a model wherein interaction of MDA-9/syntenin with c-Src promotes the formation of an active FAK/c-Src signaling complex, leading to enhanced tumor cell invasion and metastatic spread
18802114 c-Src is involved in lipoteichoic acid-induced heme oxygenase-1 expression in human cultured tracheal smooth muscle cells.
18694941 The Diaphanous-related Formin FHOD1 associates with ROCK1 and promotes Src-dependent plasma membrane blebbing.
18667434 In vascular smooth muscle cells shedding of membrane-bound epidermal growth factor (EGF) receptor ligands and activation of the nonreceptor tyrosine kinases Pyk2 and Src contributed to the thrombin-induced ERK1/2 phosphorylation.
18662984 PI3K and Src-ELMO-Dock2 pathways work in parallel to activate Rac2 and modulate chemotaxis in response to a CXCL8 gradient in neutrophils.
18644869 This study demonstrates an important role of the dynamic raft reorganization induced by CD44 clustering in eliciting the matrix-derived survival signal through the CD44-SRC-integrin beta1 axis .
18632638 analysis of PAFR activation and pleiotropic effects on tyrosine phospho-EGFR/Src/FAK/paxillin in ovarian cancer
18617000 Regulation of hERG channels by protein tyrosine kinases modifies the channel activity and thus likely alters electrophysiological properties including action potential duration and cell excitability in human heart and neurons.
18606683 study shows that TNFR1 associates with Jak2, c-Src, and PI3K in various cell types to engage signaling pathways, activate transcription factors, and modulate gene expression
18594017 PLCgamma-1 and c-Src activation contribute to HNSCC invasion downstream of EGF receptor
18594011 expression and activation of c-Src as well as EGF receptor promotes head and neck squamous cell carcinoma progression
18566211 This study reveals for the first time that alpha-catenin is a key regulator of beta-catenin transcriptional activity and that the status of alpha-catenin expression in tumor tissues might have prognostic value for Src targeted therapy
18562041 the Src-specific sites are all required for overexpressed Focal adhesion kinase to inhibit invadopodia formation.
18550772 These studies demonstrate positive cross talk between ER, c-Src, EGFR, and STAT5b in ER+ breast cancer cells.
18524994 pp60c-Src TK-activity was selectively induced by VEGF in MM tumor and ECs
18509267 The effect of OGP(10-14) on differentiation of a cancer megakaryoblast cell line and its involvement on RhoA and Src family kinases signaling pathway, was evaluated.
18503159 a critical role for a EGF-R-connected p60c-src-kinase-mediated pathway involving STAT3 and contributing to cell survival and proliferation within colorectal carcinomatumours.
18493848 Src kinase, in conjunction with antihormone therapies, effectively prevents antihormone resistance in breast cancer cells in vitro
18474606 Src phosphorylation of Bif-1 suppresses the interaction between Bif-1 and Bax, resulting in the inhibition of Bax activation during anoikis.
18467332 tau interactions with Src homology 3 domains of phosphatidylinositol 3-kinase, phospholipase Cgamma1, Grb2, and Src family kinases are regulated by phosphorylation
18463161 c-Src is an important regulator of Nox1 activity
18457834 These results suggest that Src-family tyrosine kinases, including c-Src and Lyn, are involved in formation of the cortical actin cap, which may serve as a platform of tyrosine phosphorylation signaling.
18451158 A Met/c-Src-mediated signaling pathway is a mediator of EGFR tyrosine phosphorylation and cell growth in the presence of EGFR tyrosine kinase inhibitors.
18445593 Csk serves to maintain the constancy of baseline excitatory synaptic transmission by inhibiting Src kinase-dependent synaptic plasticity in the hippocampus
18443354 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
18441016 hnRNP K binds to the 3'-untranslated region of the c-Src mRNA and inhibits its translation by blocking 80 S ribosome formation
18434302 Within the endothelial cell, p11 is required for Src kinase-mediated tyrosine phosphorylation of A2, which signals translocation of both proteins to the cell surface.
18403635 These findings suggest a novel MUC1-Src-CrkL-Rac1/Cdc42 signaling cascade following ICAM-1 ligation, through which MUC1 regulates cytoskeletal reorganization and directed cell motility during cell migration.
18397177 Rac1-dependent NADPH oxidases play a critical role in activating c-Src following hypoxia/reoxygenation injury
18388244 Role of Src kinase in the early action of TCDD through a nongenomic pathway in MCF10A cells is reported.
18353785 results demonstrate that TGFbeta1 induces alphavbeta3 integrin expression via a beta3 integrin-, c-Src-, and p38 MAPK-dependent pathway
18327819 results indicate that Src and E-cadherin may play an important role in epithelial-mesenchymal transformations, invasion, and aggressive clinicopathologic features of head and neck squamous carcinoma
18322799 Anoikis causes a down-activation of Fak, Src, Akt-1 and Erk1/2, a loss of Fak-Src association, and a sustained/enhanced activation of p38b, which is required as apoptosis/anoikis driver
18296443 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
18252715 a new signaling connection from ILK to cofilin for dynamic actin polymerization during cell adhesion, depending on the activity of ILK-associated c-Src.
18251740 These data provide direct evidence for increased activation of Src-family tyrosine kinases in the pathogenesis of hyperproliferative epidermal disorders.
18223692 Src, a nonreceptor tyrosine kinase, is overexpressed in androgen-independent prostate carcinoma
18211905 CD63 plays a role in the regulation of ROMK channels through its association with RPTPalpha, which in turn interacts with and activates Src family PTK, thus reducing ROMK activity.
18209475 This study analysed whether the serotonin transport mediated by the plasma-membrane transporter SERT is regulated by its Tyr-phosphorylation.
18180305 VE-cadherin has a role in modulating c-Src activation in VEGF signaling
18156174 Src-dependent phosphorylation at Tyr-529 facilitates inactive ERK binding to RSK2, which might be a general requirement for RSK2 activation by EGF through the MEK/ERK pathway.
18095097 c-Src is a mediator of substance P-stimulated ERK1/2 phosphorylation in human U373 MG glioblastoma cells.
18089800 Association of caspase-8 and Src may help reconcile why a potential tumor suppressor such as caspase-8 is rarely absent in cancers.
18086662 attenuation of the Erk1/2 signaling pathway is essential for andrographolide-mediated inhibition of v-Src transformation
18080320 TNF activated ERK in an EGFR and Src dependent and an EGFR and Src independent modes
18070925 there is functional conservation between Qr domains of yeast Gal11p and mammalian SRC proteins as direct targets of activator proteins in yeast.
18069897 novel mechanism of c-SRC regulation whereby in response to stress c-SRC activity is regulated, at least in part, through loss of the interaction with its inhibitor, PR55gamma
18063684 The SRC-STAT5 pathway is essential for decidualization of estrogen-primed human endometrial stromal cells.
18061419 Col-IV regulates the secretion of MMP-9 via a Src and FAK dependent pathway in MCF-7 cells
18057010 Silencing Cdc42 blocks activation of EGFR and Src induced by Ca2+ depletion, resulting in a reduction in E-cadherin degradation
18042718 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
18024423 These data suggest that phosphorylation of PDK1 on Tyr(9), distinct from Tyr(373/376), is important for PDK1/Src complex formation, leading to PDK1 activation.
18005680 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
17997837 Brk-mediated STAT5b phosphorylation leads to STAT5b transcriptional activity, and this activity is further increased by kinase active c-Src.
17974954 This study suggests that (a) PTP1B can act as an important activator of Src in colon cancer cells via dephosphorylation at Y530 of Src and (b) elevated levels of PTP1B can increase tumorigenicity of colon cancer cells by activating Src.
17967179 human breast cells are a uniquely permissive environment for HGF transactivation by Src/Stat3 which may allow for the inappropriate activation of HGF transcription during the early stages of breast transformation
17934522 These results reveal a potentially important role for CHK in Src activation and tumorigenicity in colon cancer cells.
17933561 These observations suggest that within in vivo-like conditions Src may have a leading role in the induction of sustained ERK1/2 activation through the Src/Ras/Raf pathway.
17855352 analysis of Src and C-terminal Src kinase interactions in integrin alphaIIbbeta3-mediated signaling to the cytoskeleton
17849451 TAE226-induced apoptosis in breast cancer cells with overexpressed SRC.
17804738 Colorectal cancer cells may develop acquired resistance to cetuximab via altering EGFR levels through ubiquitination and degradation and using Src kinase-mediated cell signaling for cell growth and survival.
17803936 Src was identified as Death-associated protein kinase (DAPK) regulator through their reciprocal modification of DAPK Y491/492 residues and establishes a functional link of this DAPK-regulatory circuit to tumor progression.
17785844 Endothelial Src activity is required for ICAM-mediated tyrosine phosphorylation of vascular endothelial cadherin and for efficient neutrophil migration during passage of leukocytes across the vascular endothelial monolayer.
17716980 norepinephrine stimulation activates Src tyrosine kinase and this activation is required for increased IL-6 expression
17691821 These results demonstrate that the chimeric strategy is useful for detailed dissection of the mechanistic basis of substrate specificity and regulation of protein tyrosine kinases.
17641225 c-Src controls functional association between integrin alphav-beta3 and VEGFR-2 via integrin beta3 phosphorylation.
17620427 Activated c-Src may play a role in survival, metastasis, and invasion of malignant pleural mesothelioma
17593353 Indirect evidence for an impaired src kinase regulation of I (Ca,L) together with an increased phosphatase activity suggests that a complex alteration in the kinase/phosphatase balance leads to I (Ca,L) dysregulation in chronic AF.
17574549 These findings support a novel role for RACK1 as a key regulator of cell migration and adhesion dynamics through the regulation of Src activity, and the modulation of paxillin phosphorylation at early adhesions.
17553930 E-cadherin signaling is an important activator of c-Src at cell-cell contacts, providing a key input into a signaling pathway where quantitative changes in signal strength may result in qualitative differences in functional outcome.
17537435 These results suggest that palmitoylation of Src-family kinases (SFKs) is critical for SFK localization and trafficking and implicate that two distinct trafficking pathways for SFKs may be involved in SFKs' specific functions.
17537434 The interplay between palladin, SPIN90 and Src and characterized the role of palladin and SPIN90 in platelet derived growth factor and Src-induced cytoskeletal remodeling, was analyzed.
17510314 These data suggest that Src-induced u-PAR gene expression and invasion/intravasation in vivo is also mediated via AP-1 region -190/-171, especially bound with c-Jun phosphorylated at Ser(73/63).
17471235 CD99 isoforms dictate opposite functions in tumour malignancy and metastases by activating or repressing c-Src kinase activity.
17443665 Fak/Src signaling to the PI3-K/Akt-1 and MEK/Erk pathways undergoes a differentiation state-specific uncoupling in enterocytes.
17369846 Src plays a crucial role in CUTL1-induced tumor cell migration
17325034 study elucidated a nongenomic extranuclear signal mediated by the RAR-SRC interaction that is negatively regulated by CSK and is required for RA-induced neuronal differentiation
17317726 results delineate a novel force-activated inside-out Src/PI3K/FAK/Akt pathway by which cancer cells regulate their own adhesion.
17307333 These lines of evidence suggested that a Gq-coupled receptor activates specifically p38 MAPK through lipid rafts and Src kinase activation, in which flotillins positively modulate the Gq signaling.
17224200 P60-c-src suppresses apoptosis through inhibition of caspase 8 activation in hepatoma cells.
17215324 Src and focal adhesion kinase mediate cyclic mechanical strain-induced extracellular regulated kinase phosphorylation and proliferation of pulmonary epithelial cells.
17135298 Stimulation of collagen type I secretion by TGF-beta requires a PKCdelta-Src-ERK1/2 signaling motif.
17088251 Src and Rac1 have roles in focal adhesion kinase and ERK mitogenic signaling in epithelial cells
17062641 Serum-independent growth of 5637 cells involves the transmembrane signaling cascade via EGFR ligand(s) (but not HGF), EGFR, Src and p145(met)
17056000 These results suggest that dimerization of Src plays an important role in the regulation of Src tyrosine kinase activity.
17046078 SHP1 activation, association with Src and dephosphorylation of specific proteins were dependent on extracellular calcium and maintenance of a higher cytosolic calcium plateau.
17038311 data delineate multiple PTH1R structural determinants for ERK1/2 activation and identify mechanism involving proline-rich motifs in receptor C terminus for reciprocal scaffolding of c-Src and beta-arrestin2 with a class II G-protein-coupled receptor
17030621 HSP90 binding to ErbB2 participates in regulation of src kinase activity as well as kinase stability
17018524 steps involving Src association, phosphorylation, and product release are fast, and a structural change in Csk participates in limiting the catalytic cycle
16959222 Curcumin treatment inhibited v-src gene expression in K562 chronic leukaemia cells.
16951177 inhibition may be an attractive therapeutic approach for patients with ovarian carcinoma
16894533 Genetic alterations of SRC1 are rare in prostate cancer. The nuclear protein accumulation of SRC1 seems to be mildly increased in androgen ablation resistant prostate cancers. .
16891307 A key coactivator for the proper function of HNF4 alpha in human liver and for an integrative control of multiple hepatic genes involved in metabolism and homeostasis.
16882656 extracellular matrix fragments produced by apoptotic EC initiate a state of resistance to apoptosis in fibroblasts via an alpha2beta1 integrin/SFK (Src and Fyn)/phosphatidylinositol 3-kinase (PI3K)-dependent pathway
16862215 Nicotine induces cell proliferation by beta-arrestin-mediated activation of the Src and Rb-Raf-1 pathways om ;img camcer.
16849330 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
16844778 Hsp90 inhibition transiently activates Src kinase and promotes Src-dependent p85 PI3K and Akt and Erk activation
16837460 v-Src-dependent down-regulation of the Ste20-like kinase SLK through casein kinase II.
16825188 Upon IGF-I stimulation, a complex assembles on SHPS-1 that contains SHP-2, c-Src, and Shc wherein Src phosphorylates Shc, a signaling step that is necessary for an optimal mitogenic response
16728403 the Src/Fak complex has a role in breast cancer tumorigenesis
16690617 nNOS is a new p60(src) kinase substrate essential for SST5-mediated anti-proliferative action
16636672 Study shows EGF-stimulation-induced Csk-binding protein (Cbp) tyrosine phosphorylation followed by Cbp-Csk association, in a SFK-dependent manner.
16619028 Src activation triggers Caspase-8 phosphorylation on Tyr380 and impairs Fas-induced apoptosis.
16569657 Although a key factor in TRAF6-dependent activation of PI 3-kinase, ectopic expression of Src was insufficient for NF-kappaB activation and, in contrast to NF-kappaB, was not inhibited by IRAK2.
16543952 nephrin phosphorylation results in Src kinase activation, recruitment of Nck, and assembly of actin filaments in an Nck-dependent fashion
16523241 These data suggest that FAK might differently regulate apoptosis and focal adhesion formation through site-specific, Src-dependent tyrosine phosphorylation in senescent cells.
16492668 arginine dimethylation of heterogeneous nuclear ribonucleoprotein K by protein-arginine methyltransferase 1 inhibits its interaction with c-Src
16465417 Results suggest that c-Src may be involved in the formation of giant cells in cherubism, central giant cell granuloma and giant cell tumors.
16441665 Data show that the interaction between Src and major vault protein (MVP) is critically dependent on Src activity and protein (MVP) tyrosyl phosphorylation, which are induced by epidermal growth factor stimulation.
16440311 The results demonstrate that collagen-evoked ectodomain cleavage of DDR1 is mediated in part by Src-dependent activation
16414009 IR-induced ERK1/2 activation involves EGFR through a Src-dependent pathway that is distinct from EGFR ligand activation
16412380 These studies also raise the possibility that fully active forms of c-Src and Fak in breast tumors.
16407214 Epidermal growth factor receptor exposed to oxidative stress undergoes Src- and caveolin-1-dependent perinuclear trafficking
16400523 Cells with single Src family kinase knockdown show that Src, Fyn and Yes kinases are all required for vascular endothelial growth factor (VEGF) mitogenic signaling.
16377083 Stat3 downregulation in vSrc transformed NIH3T3 cells or in breast cancer lines with activated Src induces apoptosis, but in normal cells Stat3 inhibition at post-confluence causes apoptosis while in sparsely growing cells it induces growth retardation
16371650 Data suggest a model in which netrin stimulates UNC5 tyrosine phosphorylation and signaling in a manner dependent on the co-receptor DCC, through the recruitment of Src and FAK kinases.
16322069 LPC-induced Flk-1/KDR transactivation via c-Src may have important implications for the progression of atherosclerosis
16317091 rhMIF induced VCAM-1 and ICAM-1 up-regulation in 12 hours via Src, PI3K, and NFkappaB
16260653 FAK regulates integrin-dependent MMP-2 and MMP-9 expression and release by T lymphoid cells through src kinase
16168436 Data report three crystal structures of a dimeric active c-Src kinase domain, in an apo and two ligand complexed forms, with resolutions ranging from 2.9A to 1.95A.
16163059 Src activity contributes to constitutive and EGF-induced VEGF expression and angiogenic potential in pancreatic cancer cells
16158247 The Src, a proto-oncogene, has been strongly implicated in the growth, progression and metastasis of a number of human cancers.
16158055 MUC1 is delivered to mitochondria by a mechanism involving activation of the ErbB receptor-->c-Src pathway and transport by the molecular chaperone HSP70/HSP90 complex
16105876 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
16055703 Semaphorin 4D/plexin-B1 induces endothelial cell migration through the activation of PYK2, Src, and the phosphatidylinositol 3-kinase-Akt pathway
16002577 c-Src tyrosine kinase was identified as a binding partner of the BMPR-II C-terminus.
15872089 dynamin, Cbl, and Src coordinately participate in signaling complexes that are important in the assembly and remodeling of the actin cytoskeleton, leading to changes in osteoclast adhesion, migration, and resorption
15872086 calcium activates PLC-gamma1 via increased PIP3 formation mediated by c-src- and fyn-activated PI3K
15853660 This review summarizes some of the latest evidence for the role of c-Src in tumorigenesis and particularly in human tumor progression.
15818752 c-src codon 531 mutation in colorectal cancer is not the cause of c-src activation.
15777850 a specific cross-talk between TGF-beta1 and fibronectin-binding integrin signal pathways leads to the activation of c-Src/Rac1/actin-organization, leading to changes in cell cycle regulator levels in hepatoma cells
15774483 results indicated that Src kinase-dependent tyrosine phosphorylation of p47(phox) regulates hyperoxia-induced NADPH oxidase activation and reactive oxygen species production in human pulmonary artery endothelial cells
15746183 data demonstrate that Src tyrosine kinase modulates human airway smooth muscle (ASM) cell proliferation and migration
15735682 HIF-1alpha, STAT3, CBP/p300 and Ref-1/APE regulate Src-dependent hypoxia-induced expression of VEGF in pancreatic and prostate carcinomas
15689620 Data show that ionizing radiation causes stress-induced activation of insulin-like growth factor-1 receptor-Src-Mek-Erk-Egr-1 signaling that regulates the clusterin pro-survival cascade.
15688032 SRC-1 is a novel Smad3/4 transcriptional partner, facilitating the functional link between Smad3 and p300/CBP.
15647376 Src-dependent ezrin phosphorylation has a role in adhesion-mediated events in epithelial cells
15638726 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
15637072 Involvement of c-Src and protein kinase C delta in the inhibition of Cl(-)/OH- exchange activity in Caco-2 cells by serotonin.
15623525 Src phosphorylates ezrin at tyrosine 477
15623523 Csk achieves a low K(m) for the substrate Src, not by stabilizing protein-protein interactions but rather by facilitating a fast phosphoryl transfer step
15618223 PMA transactivates the EGFR and increases cell proliferation by activating the PKCdelta/c-Src pathway in glioblastoma cells
15583006 there is a complex interplay between PKCalpha, Syk, and Src involving physical interaction, phosphorylation, translocation within the cell, and functional activity regulation
15564375 FRS2-dependent SRC activation is required for FGFR-induced phosphorylation of Sprouty and suppression of ERK activity
15532711 ERK activation mediated pure pressure-induced proliferative response of aortic smooth muscle cells. This activation was partly mediated by c-Src.
15528270 src kinase potentiates tamoxifen agonist action through serine 167-dependent stabilization of estrogen receptor promoter interaction and through elevation of SRC-1 and cAMP response element binding protein-binding protein coactivation of ER
15522237 Data demonstrate that type I collagen synergistically enhances platelet-derived growth factor (PDGF)-induced smooth muscle cell proliferation through Src-dependent crosstalk between the alpha2beta1 integrin and the PDGF receptor beta.
15498833 c-Src has a role in regulating the dissociation of AP-2 from agonist-occupied AT1R and beta-arrestin during the clathrin-mediated internalization of receptors
15494217 c-Src participates in regulating the endocytosis of PDGFbeta receptor-GPCR complexes in response to PDGF.
15485865 G16-mediated activation of nuclear factor kappaB by the adenosine A1 receptor requires c-Src, protein kinase C, and ERK signaling
15467744 Fibronectin and type IV collagen activate ERalpha AF-1 by the c-Src pathway in breast cancer
15456896 Src inhibitors inhibited COX-2 induction in Helicobacter pylori infected gastric mucosa cells.
15297464 colony stimulating factor 1 receptor phosphorylation was not markedly affected by Src-family kinases (SFK) inhibition, indicating that lack of SFK binding is not responsible for diminished Y559F phosphorylation.
15286700 A prolactin signalling cascade in W53 cells involves Src kinases that mediate stimulation of c-Myc expression.
15276210 Results provide important insight to the mechanism of SRC transcriptional activation in liver cancer cells.
15271991 Src plays an obligatory role in the mechanism for receptor and diacylglycerol activation of TRPC3
15254245 Src kinase activity is suppressed by RAC1, which regulates G1/S progression
15117969 data suggest that colony-stimulating factor receptor-1R (CSF-1R) disrupts cell adhesion by uncoupling adherens junction complexes from the cytoskeleton and promoting cadherin internalization through a Src-dependent mechanism
15094065 hTAF(II)68-mediated transactivation is linked to the cytoplasmic Src signal transduction pathway. The hTAF(II)68 protein can associate with the SH3 domains of several cell signaling proteins, including v-Src.
15078178 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
15075377 SH2 and SH3 domains of Src mediate peripheral accumulation of phospho-myosin, leading to integrin adhesion complex assembly, whereas loss of SH2 or SH3 function restores normal regulation of E-cadherin and inhibits vimentin expression
15062576 both the androgen receptor interacting domains of the coactivator SRC1 and of the corepressor SMRT compete for interaction with the androgen receptor N-terminus
15060621 mechanisms of c-Src activation in human cancer (review)
15033452 src and protein kinase C have roles in inducing phosphorylation of p38 mitogen-activated protein kinase in epithelial cells after mechanical pressure
14963038 EGFR and c-Src-mediated Stat-3 activation is facilitated by Pyk2
14766744 Ret tyrosine 981 constitutes the major binding site of the Src homology 2 domain of Src and therefore the primary residue responsible for Src activation upon Ret engagement
14706618 v-Src and receptor tyrosine kinase ErbB2 activate beta-catenin-TCF-mediated transcription.
14676843 A novel regulatory network RAFTK/Pyk2, Src and p38 appears to be critical for VEGF-induced endothelial cell migration.
14670955 data suggest that agonist-induced binding of Src kinase to the Src homology 3 binding sites in the P2Y(2) purinergic receptor facilitates Src activation and allows Src to efficiently phosphorylate the epidermal growth factor receptor
14627343 role of IGF-1R and c-Src in human pancreatic carcinogenesis. Coexpression of both these molecules may play important role in transformation of pancreatic ductal cells.
14617636 focal adhesion kinase and src are stimulated by G alpha q and platelet activating factor receptor in vascular endothelium
14562045 The data indicate an increase in the expression and total activity of endogenous p60(c-Src) in several GM-CSF-independent 1 cultured leukemia cell mutants.
14523024 c-src activation of PLCgamma is mediated by GIT1
14504278 SRC tyrosine kinases are activated and have a role in tyrosine phosphorylation of ezrin and activation of p38
12975382 Src has an appreciable role in the organization of the Golgi apparatus, which may be linked to its involvement in protein transport from the Golgi apparatus to the endoplasmic reticulum
12947321 Inhibition of Src signaling results in a marked reduction of pancreatic cancer cellular invasiveness. Src may represent a novel therapeutic target for this deadly cancer.
12939401 FAK and Src are both important survival factors, playing a role in protecting colon cancer cell lines from Adenovirus-containing FAK-CD (Ad-FAK-CD)-induced apoptosis
12907754 role of c-Src on PRL-stimulated proliferation of T47D and MCF7 breast cancer cells
12893822 v-SRC regulates the nucleo-cytoplasmic delocalization of the major isoform of TEL-ETV6
12842760 involvement of G(i), Src tyrosine kinase and PI3 Kinase, respectively, in TNFalpha production
12829810 stimulated by HBX protein acting on the mitochondrial transition pore and effecting hepatitis B virus replication.
12734410 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
12663375 c-Src regulates NAD(P)H oxidase-derived *O2- generation acutely by stimulating p47phox phosphorylation and translocation and chronically by increasing protein content of gp91phox, p22phox, and p47phox in Ang II-stimulated cells.
12631284 Results demonstrate that c-Src and TRAF6 are key mediators of interleukin-1-induced AP-1 activation and provide evidence of cross talk between c-Src and TRAF6 molecules through PI3 kinase-Akt-JNK pathways.
12618767 c-Src, lacking cysteine at position 520, is resistant to 1 microM N-(9-acridinyl) maleimide (NAM) but sensitive to 5 microM. Changing Phe520 to cysteine made it sensitive to 1 microM. Double mutation in clustered cysteines restored resistance to 5 microM.
12604776 src has a role in promoting destruction of c-Cbl and enabling EGFR to evade desensitization as part of an oncogenesis pathway
12462387 c-Src activation is associated with early stages of breast carcinomas with low aggressiveness.
12456372 Mutual interaction of c-Src with EGFR is required for many EGFR-mediated cellular functions including proliferation, migration, survival and EGFR endocytosis, as discussed in this review.
12429837 Data report a novel positioning of Src, mediating signals from insulin to phosphatidylinositol 3-kinase and to beta(2)-adrenergic receptor trafficking.
12429742 mediation of synergism with epidermal growth factor receptor by STAT5b
12420216 Src activation may contribute to colon tumor progression and metastasis in part by activating Akt-mediated survival pathways that decrease sensitivity of detached cells to anoikis.
12416028 pp60c-src may be involved in stabilization of dynamic HT-29 cell adhesion to ECM components, and this kinase appears to be part of a mechanosensory protein complex during integrin-mediated cell adhesion
12393736 The p85 subunit of PI 3-kinase activates Src independently of the enzymatic activity of PI 3- kinase. Ligand binding of GPIb, without receptor clustering, is sufficient to activate Src.
12216109 Functional involvement of src and focal adhesion kinase in a CD99 splice variant-induced motility of human breast cancer cells
12162444 REVIEW: Arsenic carcinogenicity: relevance of c-Src activation
12063167 Activation of a Src-dependent Raf-MEK1/2-ERK signaling pathway is required for IL-1alpha-induced upregulation of beta-defensin 2 in human middle ear epithelial cells.
12060669 The Src-cortactin pathway is required for clustering of E-selectin and ICAM-1 in endothelial cells
12014986 PLD1 is threonine-phosphorylated in human-airway epithelial cells by a PKCdelta and src dependent mechanism
11994743 v-Src's hold over actin and cell adhesions.
11940607 Coordinate interactions of Csk, Src, and Syk kinases with [alpha]IIb[beta]3 initiate integrin signaling to the cytoskeleton.
9778343 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells
9621077 HIV-1 Tat and cocaine treatment upregulates the expreesion of phophorylated SRC protein in human pulmonary arterial smooth muscle cells

AA Sequence

MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSS      1 - 70
DTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYV     71 - 140
APSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKL    141 - 210
DSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGC    211 - 280
FGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL    281 - 350
DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT    351 - 420
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC    421 - 490
PESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL                            491 - 536
//

Text Mined References (1007)

PMID Year Title
27097314 2016 Circulating Fibroblast Growth Factor-2, HIV-Tat, and Vascular Endothelial Cell Growth Factor-A in HIV-Infected Children with Renal Disease Activate Rho-A and Src in Cultured Renal Endothelial Cells.
26923073 2016 A synthetic isoflavone, DCMF, promotes human keratinocyte migration by activating Src/FAK signaling pathway.
26866924 2016 Novel Role of Src in Priming Pyk2 Phosphorylation.
26866809 2016 Microtubule and Actin Interplay Drive Intracellular c-Src Trafficking.
26549523 2015 An EGFR/Src-dependent ?4 integrin/FAK complex contributes to malignancy of breast cancer.
26460485 2015 Deregulated Expression of SRC, LYN and CKB Kinases by DNA Methylation and Its Potential Role in Gastric Cancer Invasiveness and Metastasis.
26399481 2015 The activating role of phospho-(Tyr)-calmodulin on the epidermal growth factor receptor.
26393498 2015 17?-Estradiol induces odontoblastic differentiation via activation of the c-Src/MAPK pathway in human dental pulp cells.
26358373 2015 Combinatorial treatment using targeted MEK and SRC inhibitors synergistically abrogates tumor cell growth and induces mesenchymal-epithelial transition in non-small-cell lung carcinoma.
26325669 2015 Src inhibitors act through different mechanisms in Non-Small Cell Lung Cancer models depending on EGFR and RAS mutational status.
26296907 2015 The Src non-receptor tyrosine kinase paradigm: New insights into mammalian Sertoli cell biology.
26261043 2015 Subcellular and Dynamic Coordination between Src Activity and Cell Protrusion in Microenvironment.
26258764 2015 SH3 domain of c-Src governs its dynamics at focal adhesions and the cell membrane.
26252487 2015 Ligands Binding to Cell Surface Ganglioside GD2 Cause Src-Dependent Activation of N-Methyl-D-Aspartate Receptor Signaling and Changes in Cellular Morphology.
26205662 2015 Tyr724 phosphorylation of ELMO1 by Src is involved in cell spreading and migration via Rac1 activation.
26200837 2016 The RANK Pathway in Advanced Breast Cancer: Does Src Play a Role?
26198631 2015 Regulation of Yin Yang 1 by Tyrosine Phosphorylation.
26173590 2015 Tumor necrosis factor-alpha induces VCAM-1-mediated inflammation via c-Src-dependent transactivation of EGF receptors in human cardiac fibroblasts.
26082485 2015 Steroid Receptor Coactivator 1 Promotes Human Hepatocellular Carcinoma Progression by Enhancing Wnt/?-Catenin Signaling.
26041409 2015 Src/STAT3-dependent heme oxygenase-1 induction mediates chemoresistance of breast cancer cells to doxorubicin by promoting autophagy.
26037143 2015 Kindlin-2 phosphorylation by Src at Y193 enhances Src activity and is involved in Migfilin recruitment to the focal adhesions.
26032498 2015 Spondin 1 promotes metastatic progression through Fak and Src dependent pathway in human osteosarcoma.
26011449 2015 Src Family Kinases (SFK) Mediate Angiotensin II-Induced Myosin Light Chain Phosphorylation and Hypertension.
25982272 2016 Stromal fibroblasts facilitate cancer cell invasion by a novel invadopodia-independent matrix degradation process.
25979842 2015 CD44 regulates cell proliferation, migration, and invasion via modulation of c-Src transcription in human breast cancer cells.
25961473 2015 Conformation-Dependent Human p52Shc Phosphorylation by Human c-Src.
25958313 2015 The role of c-Src in the invasion and metastasis of hepatocellular carcinoma cells induced by association of cell surface GRP78 with activated ?2M.
25948553 2015 Src inhibitors modulate frataxin protein levels.
25947380 2015 The Tyrosine Kinase c-Src Specifically Binds to the Active Integrin ?IIb?3 to Initiate Outside-in Signaling in Platelets.
25922567 2015 The dietary flavonoid Kaempferol mediates anti-inflammatory responses via the Src, Syk, IRAK1, and IRAK4 molecular targets.
25921464 2015 c-Src-dependent transactivation of EGFR mediates CORM-2-induced HO-1 expression in human tracheal smooth muscle cells.
25914053 2015 The SH3 Domain Acts as a Scaffold for the N-Terminal Intrinsically Disordered Regions of c-Src.
25897081 2015 Protein-tyrosine Phosphatase and Kinase Specificity in Regulation of SRC and Breast Tumor Kinase.
25867068 2016 Fer tyrosine kinase oligomer mediates and amplifies Src-induced tumor progression.
25820822 2015 Aflatoxin B1 induces Src phosphorylation and stimulates lung cancer cell migration.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25805816 2015 Src-family protein tyrosine kinase phosphorylates WNK4 and modulates its inhibitory effect on KCNJ1 (ROMK).
25802280 2015 Loss of Androgen-Regulated MicroRNA 1 Activates SRC and Promotes Prostate Cancer Bone Metastasis.
25802190 2015 Src enhances osteogenic differentiation through phosphorylation of Osterix.
25730905 2015 Androgen receptor non-nuclear regulation of prostate cancer cell invasion mediated by Src and matriptase.
25725252 2015 The prognostic significance of Src and p-Src expression in patients with osteosarcoma.
25711159 2015 Focal adhesion kinase and Src expression in premalignant and malignant skin lesions.
25635050 2015 Src-dependent tyrosine phosphorylation of non-muscle myosin heavy chain-IIA restricts Listeria monocytogenes cellular infection.
25585026 2015 TGF?1 rapidly activates Src through a non-canonical redox signaling mechanism.
25554601 2015 Src blockage by siRNA inhibits VEGF-induced vascular hyperpemeability and osteoclast activity - an in vitro mechanism study for preventing destructive repair of osteonecrosis.
25533622 2015 Radiation promotes malignant phenotypes through SRC in breast cancer cells.
25523213 2014 The Escherichia coli effector EspJ blocks Src kinase activity via amidation and ADP ribosylation.
25517315 2014 Inhibitors of SRC kinases impair antitumor activity of anti-CD20 monoclonal antibodies.
25501895 2015 c-Src mediated tyrosine phosphorylation of plakophilin 3 as a new mechanism to control desmosome composition in cells exposed to oxidative stress.
25477471 2015 Cyclic stretch-induced TGF-?1 and fibronectin expression is mediated by ?1-integrin through c-Src- and STAT3-dependent pathways in renal epithelial cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25452256 2014 CCR5 receptor antagonists block metastasis to bone of v-Src oncogene-transformed metastatic prostate cancer cell lines.
25428919 2015 CD147 promotes Src-dependent activation of Rac1 signaling through STAT3/DOCK8 during the motility of hepatocellular carcinoma cells.
25392346 2015 The TWEAK Receptor Fn14 Is an Src-Inducible Protein and a Positive Regulator of Src-Driven Cell Invasion.
25362852 2015 The polyomavirus middle T-antigen oncogene activates the Hippo pathway tumor suppressor Lats in a Src-dependent manner.
25359883 2014 Eps8 controls Src- and FAK-dependent phenotypes in squamous carcinoma cells.
25350844 2014 Src mutation induces acquired lapatinib resistance in ERBB2-amplified human gastroesophageal adenocarcinoma models.
25301365 2014 Membrane androgen receptor down-regulates c-src-activity and beta-catenin transcription and triggers GSK-3beta-phosphorylation in colon tumor cells.
25287652 2015 Missing-in-Metastasis regulates cell motility and invasion via PTP?-mediated changes in SRC activity.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25237194 2014 Kindlin-2 tyrosine phosphorylation and interaction with Src serve as a regulatable switch in the integrin outside-in signaling circuit.
25201048 2015 Sphingosine-1-phosphate mediates COX-2 expression and PGE2 /IL-6 secretion via c-Src-dependent AP-1 activation.
25197973 2014 c-Src binds to the cancer drug Ruxolitinib with an active conformation.
25195599 2015 Antitumor activity of miR-1280 in melanoma by regulation of Src.
25193862 2014 Overcoming EMT-associated resistance to anti-cancer drugs via Src/FAK pathway inhibition.
25187556 2014 Direct regulation of GAS6/AXL signaling by HIF promotes renal metastasis through SRC and MET.
25181017 2014 Compound K inhibits MMP-1 expression through suppression of c-Src-dependent ERK activation in TNF-?-stimulated dermal fibroblast.
25164009 2014 Activated d16HER2 homodimers and SRC kinase mediate optimal efficacy for trastuzumab.
25157407 2014 Distinctive subcellular inhibition of cytokine-induced SRC by salubrinal and fluid flow.
25157176 2014 Src promotes GTPase activity of Ras via tyrosine 32 phosphorylation.
25117710 2014 Phosphorylation of ETS1 by Src family kinases prevents its recognition by the COP1 tumor suppressor.
25116152 2014 Computational approaches for evaluating the effect of sequence variations and the intrinsically disordered C-terminal region of the Helicobacter pylori CagA protein on the interaction with tyrosine kinase Src.
25084697 2014 Cbl negatively regulates erythropoietin-induced growth and survival signaling through the proteasomal degradation of Src kinase.
25074934 2014 Cell surface epidermal growth factor receptors increase Src and c-Cbl activity and receptor ubiquitylation.
25070888 2014 Src-mediated post-translational regulation of endoglin stability and function is critical for angiogenesis.
25028927 2014 Gene expression profiling in leiomyosarcomas and undifferentiated pleomorphic sarcomas: SRC as a new diagnostic marker.
25006397 2013 Nitrosation-dependent caveolin 1 phosphorylation, ubiquitination, and degradation and its association with idiopathic pulmonary arterial hypertension.
24983503 2014 Phosphorylation of flotillin-1 by mitochondrial c-Src is required to prevent the production of reactive oxygen species.
24971543 2014 v-Src inhibits the interaction between Rad17 and Rad9 and induces replication fork collapse.
24967003 2014 PELP1 suppression inhibits colorectal cancer through c-Src downregulation.
24937674 2014 Src, a potential target for overcoming trastuzumab resistance in HER2-positive breast carcinoma.
24903382 2014 Silencing of Src by siRNA inhibits laryngeal carcinoma growth through the Src/PI-3 K/Akt pathway in vitro and in vivo.
24887236 2014 Epidermal growth factor-receptor activation modulates Src-dependent resistance to lapatinib in breast cancer models.
24863135 2014 Endoplasmic reticulum stress induces epithelial-mesenchymal transition through autophagy via activation of c-Src kinase.
24840271 2014 Src/caveolin-1-regulated EGFR activation antagonizes TRAIL-induced apoptosis in gastric cancer cells.
24824657 2014 Reactive oxygen species induce the association of SHP-1 with c-Src and the oxidation of both to enhance osteoclast survival.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24722904 2014 Cyclic stretch disrupts apical junctional complexes in Caco-2 cell monolayers by a JNK-2-, c-Src-, and MLCK-dependent mechanism.
24714091 2014 Cetuximab-induced MET activation acts as a novel resistance mechanism in colon cancer cells.
24708996 2014 Regulation of alkaline ceramidase activity by the c-Src-mediated pathway.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24644285 2014 Epithelial membrane protein-2 (EMP2) activates Src protein and is a novel therapeutic target for glioblastoma.
24634213 2014 Src family kinases promote silencing of ATR-Chk1 signaling in termination of DNA damage checkpoint.
24587194 2014 Regulation of hERG and hEAG channels by Src and by SHP-1 tyrosine phosphatase via an ITIM region in the cyclic nucleotide binding domain.
24481818 2014 Regulation of Src trafficking and activation by the endocytic regulatory proteins MICAL-L1 and EHD1.
24469069 2014 CXCL4L1 and CXCL4 signaling in human lymphatic and microvascular endothelial cells and activated lymphocytes: involvement of mitogen-activated protein (MAP) kinases, Src and p70S6 kinase.
24457967 2014 A cell-penetrating peptide based on the interaction between c-Src and connexin43 reverses glioma stem cell phenotype.
24440771 2014 Src mediates ERK reactivation in gefitinib resistance in non-small cell lung cancer.
24407236 2014 Antioxidants decrease the apoptotic effect of 5-Fu in colon cancer by regulating Src-dependent caspase-7 phosphorylation.
24403252 2013 Src controls castration recurrence of CWR22 prostate cancer xenografts.
24390736 2014 Bufalin is a potent small-molecule inhibitor of the steroid receptor coactivators SRC-3 and SRC-1.
24369899 2013 c-Src activation through a TrkA and c-Src interaction is essential for cell proliferation and hematological malignancies.
24328683 2014 Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of plakophilin 3 and its detachment from desmoglein 3.
24296779 2014 Amplification of MPZL1/PZR promotes tumor cell migration through Src-mediated phosphorylation of cortactin in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239173 2014 By inhibiting Src, verapamil and dasatinib overcome multidrug resistance via increased expression of Bim and decreased expressions of MDR1 and survivin in human multidrug-resistant myeloma cells.
24200972 2014 Src and CXCR4 are involved in the invasiveness of breast cancer cells with acquired resistance to lapatinib.
24196445 2014 Src kinase modulates the apoptotic p53 pathway by altering HIPK2 localization.
24183378 2014 Inhibition of c-Src blocks oestrogen-induced apoptosis and restores oestrogen-stimulated growth in long-term oestrogen-deprived breast cancer cells.
24151076 2013 Phosphatidylinositol phosphate 5-kinase I?i2 in association with Src controls anchorage-independent growth of tumor cells.
24142406 2014 Pyk2 and Src mediate signaling to CCL18-induced breast cancer metastasis.
24136222 2013 Myotonic dystrophy protein kinase (DMPK) prevents ROS-induced cell death by assembling a hexokinase II-Src complex on the mitochondrial surface.
24126923 2013 Co-expression of Rho guanine nucleotide exchange factor 5 and Src associates with poor prognosis of patients with resected non-small cell lung cancer.
24123009 2013 Effects of SRC and STAT3 upon gap junctional, intercellular communication in lung cancer lines.
24120917 2014 Down-regulation of lipid raft-associated onco-proteins via cholesterol-dependent lipid raft internalization in docosahexaenoic acid-induced apoptosis.
24108181 2013 Network analysis of neurotransmitter related human kinase genes: possible role of SRC, RAF1, PTK2B?
24100030 2013 Regulation of the Src-PP2A interaction in tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-induced apoptosis.
24069415 2013 c-Src and neural Wiskott-Aldrich syndrome protein (N-WASP) promote low oxygen-induced accelerated brain invasion by gliomas.
24058594 2013 The overexpression of scaffolding protein NEDD9 promotes migration and invasion in cervical cancer via tyrosine phosphorylated FAK and SRC.
24037722 2013 COX-2, TFF1, and Src define better prognosis in young patients with gastric cancer.
24036928 2013 Integrin-?5 and zyxin mediate formation of ventral stress fibers in response to transforming growth factor ?.
24034250 2013 EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.
24007880 2013 Src plays a key role in ADAM28 expression in v-src-transformed epithelial cells and human carcinoma cells.
23991004 2013 Impact of flavonoids on matrix metalloproteinase secretion and invadopodia formation in highly invasive A431-III cancer cells.
23955631 2013 Sprouty4 regulates endothelial cell migration via modulating integrin ?3 stability through c-Src.
23954233 2013 Cysteine mutations cause defective tyrosine phosphorylation in MEGF10 myopathy.
23949219 2013 MBNL142 and MBNL143 gene isoforms, overexpressed in DM1-patient muscle, encode for nuclear proteins interacting with Src family kinases.
23940647 2013 C-src enriched serum microvesicles are generated in malignant plasma cell dyscrasia.
23920124 2013 Guggulsterone decreases proliferation and metastatic behavior of pancreatic cancer cells by modulating JAK/STAT and Src/FAK signaling.
23913837 2013 Structural insights into the recognition of ?3 integrin cytoplasmic tail by the SH3 domain of Src kinase.
23913825 2013 SRC family kinases as novel therapeutic targets to treat breast cancer brain metastases.
23882690 2013 Role of PKC? activation of Src, PI-3K/AKT, and ERK in EGF-stimulated proliferation of rat and human conjunctival goblet cells.
23873931 2013 Src family protein tyrosine kinase regulates the basolateral K channel in the distal convoluted tubule (DCT) by phosphorylation of KCNJ10 protein.
23804646 2013 Interferon regulatory factor 4 is activated through c-Src-mediated tyrosine phosphorylation in virus-transformed cells.
23790975 2013 Posttranscriptional deregulation of Src due to aberrant miR34a and miR203 contributes to gastric cancer development.
23751956 Src-inducible association of CrkL with procaspase-8 promotes cell migration.
23726918 2013 Differential anti-tumor activities of curcumin against Ras- and Src-activated human adenocarcinoma cells.
23707526 2013 The tyrosine kinase CSK associates with FLT3 and c-Kit receptors and regulates downstream signaling.
23703528 2013 PLC-? directly binds activated c-Src, which is necessary for carbachol-mediated inhibition of NHE3 activity in Caco-2/BBe cells.
23696930 2013 Phosphorylated c-Src is a novel predictor for recurrence in cervical squamous cell cancer patients.
23651497 2013 A signaling cascade mediated by ceramide, src and PDGFR? coordinates the activation of the redox-sensitive neutral sphingomyelinase-2 and sphingosine kinase-1.
23644655 2014 Macrophages stimulate gastric and colorectal cancer invasion through EGFR Y(1086), c-Src, Erk1/2 and Akt phosphorylation and smallGTPase activity.
23640056 2013 Tissue transglutaminase regulates ?-catenin signaling through a c-Src-dependent mechanism.
23615537 2013 c-Src regulates cell cycle proteins expression through protein kinase B/glycogen synthase kinase 3 beta and extracellular signal-regulated kinases 1/2 pathways in MCF-7 cells.
23585863 2013 Src regulates the activity of the ING1 tumor suppressor.
23585225 2013 LPS induces pp60c-src-mediated tyrosine phosphorylation of Hsp90 in lung vascular endothelial cells and mouse lung.
23564345 2013 Molecular chaperone TRAP1 regulates a metabolic switch between mitochondrial respiration and aerobic glycolysis.
23563312 2013 HIF1? and HIF2? independently activate SRC to promote melanoma metastases.
23562843 2013 v-Src causes delocalization of Mklp1, Aurora B, and INCENP from the spindle midzone during cytokinesis failure.
23536784 2013 A novel 3D fibril force assay implicates src in tumor cell force generation in collagen networks.
23532252 2013 PTP?-mediated Src activation by EGF in human breast cancer cells.
23500080 2013 Oroxylin A sensitizes non-small cell lung cancer cells to anoikis via glucose-deprivation-like mechanisms: c-Src and hexokinase II.
23497302 2013 Activation of Src, Fyn and Yes non-receptor tyrosine kinases in keratinocytes expressing human papillomavirus (HPV) type 16 E7 oncoprotein.
23400779 2013 A truncated fragment of Src protein kinase generated by calpain-mediated cleavage is a mediator of neuronal death in excitotoxicity.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23393555 2013 Genome-wide association study of retinopathy in individuals without diabetes.
23380740 2013 Rapid activation receptor- or IL-2-induced lytic granule convergence in human natural killer cells requires Src, but not downstream signaling.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23360994 2013 Src activation by ?-adrenoreceptors is a key switch for tumour metastasis.
23349873 2013 ATP-mediated transactivation of the epidermal growth factor receptor in airway epithelial cells involves DUOX1-dependent oxidation of Src and ADAM17.
23341451 2013 Fucoidan is a novel platelet agonist for the C-type lectin-like receptor 2 (CLEC-2).
23338526 2013 Downregulation of Src enhances the cytotoxic effect of temozolomide through AKT in glioma.
23292187 2013 Monosodium urate activates Src/Pyk2/PI3 kinase and cathepsin dependent unconventional protein secretion from human primary macrophages.
23291984 2013 Brk/PTK6 cooperates with HER2 and Src in regulating breast cancer cell survival and epithelial-to-mesenchymal transition.
23281368 2013 Monovalent and multivalent ligation of the B cell receptor exhibit differential dependence upon Syk and Src family kinases.
23277333 2013 Expression of c-Src and phospho-Src in epithelial ovarian carcinoma.
23271399 2013 Targeting the yin and the yang: combined inhibition of the tyrosine kinase c-Src and the tyrosine phosphatase SHP-2 disrupts pancreatic cancer signaling and biology in vitro and tumor formation in vivo.
23242808 2013 Inhibiting EGF receptor or SRC family kinase signaling overcomes BRAF inhibitor resistance in melanoma.
23209645 2012 Rap1 can bypass the FAK-Src-Paxillin cascade to induce cell spreading and focal adhesion formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23179791 2013 Role of LOXs and COX-2 on FAK activation and cell migration induced by linoleic acid in MDA-MB-231 breast cancer cells.
23178654 2013 Folic acid inhibits endothelial cell migration through inhibiting the RhoA activity mediated by activating the folic acid receptor/cSrc/p190RhoGAP-signaling pathway.
23119029 2012 Src-mediated cross-talk between farnesoid X and epidermal growth factor receptors inhibits human intestinal cell proliferation and tumorigenesis.
23066026 2012 The Src family kinases and protein kinase C synergize to mediate Gq-dependent platelet activation.
23065768 2012 Activation of rapid oestrogen signalling in aggressive human breast cancers.
22957062 2012 Knocking down low molecular weight protein tyrosine phosphatase (LMW-PTP) reverts chemoresistance through inactivation of Src and Bcr-Abl proteins.
22957061 2012 Reciprocal regulation of annexin A2 and EGFR with Her-2 in Her-2 negative and herceptin-resistant breast cancer.
22927910 2012 A switch role of Src in the biphasic EGF signaling of ER-negative breast cancer cells.
22888118 2012 Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c.
22880054 2012 Src kinase and Syk activation initiate PI3K signaling by a chimeric latent membrane protein 1 in Epstein-Barr virus (EBV)+ B cell lymphomas.
22865929 2012 ER? phosphorylation at Y537 by Src triggers E6-AP-ER? binding, ER? ubiquitylation, promoter occupancy, and target gene expression.
22833562 2012 CIN85 phosphorylation is essential for EGFR ubiquitination and sorting into multivesicular bodies.
22810232 2012 Involvement of c-Src tyrosine kinase upstream of class I phosphatidylinositol (PI) 3-kinases in Salmonella Enteritidis Rck protein-mediated invasion.
22768099 2012 Cell invasion by Neisseria meningitidis requires a functional interplay between the focal adhesion kinase, Src and cortactin.
22760497 2012 CD24 controls Src/STAT3 activity in human tumors.
22732588 2012 Interchangeability of Themis1 and Themis2 in thymocyte development reveals two related proteins with conserved molecular function.
22716210 2012 c-Src expression is predictive of poor prognosis in breast cancer patients with bone metastasis, but not in patients with visceral metastasis.
22710723 2013 Identification and functional characterization of p130Cas as a substrate of protein tyrosine phosphatase nonreceptor 14.
22689581 2012 c-Src but not Fyn promotes proper spindle orientation in early prometaphase.
22675553 2012 Hepatocyte growth factor increases osteopontin expression in human osteoblasts through PI3K, Akt, c-Src, and AP-1 signaling pathway.
22660634 2012 A new isoform of steroid receptor coactivator-1 is crucial for pathogenic progression of endometriosis.
22658320 2012 Modulating therapeutic effects of the c-Src inhibitor via oestrogen receptor and human epidermal growth factor receptor 2 in breast cancer cell lines.
22653778 2013 Bradykinin enhances cell migration in human prostate cancer cells through B2 receptor/PKC?/c-Src dependent signaling pathway.
22591684 2012 Src, Akt, NF-?B, BCL-2 and c-IAP1 may be involved in an anti-apoptotic effect in patients with BCR-ABL positive and BCR-ABL negative acute lymphoblastic leukemia.
22586492 2012 EGFR-mediated carcinoma cell metastasis mediated by integrin ?v?5 depends on activation of c-Src and cleavage of MUC1.
22581261 2012 DOCK8 functions as an adaptor that links TLR-MyD88 signaling to B cell activation.
22577255 2012 Syk/Src pathway-targeted inhibition of skin inflammatory responses by carnosic acid.
22577141 2012 Sperm epidermal growth factor receptor (EGFR) mediates ?7 acetylcholine receptor (AChR) activation to promote fertilization.
22532564 2012 Protein kinase C? and Src kinase support human prostate-distributed dihydrotestosterone-metabolizing UDP-glucuronosyltransferase 2B15 activity.
22508042 2012 EMT phenotype is induced by increased Src kinase activity via Src-mediated caspase-8 phosphorylation.
22488171 2012 FAK and Src expression in mobile tongue squamous cell carcinoma: associations with clinicopathological parameters and patients survival.
22479394 2012 The tyrosine kinase c-Src directly mediates growth factor-induced Notch-1 and Furin interaction and Notch-1 activation in pancreatic cancer cells.
22439932 2012 NKX2-1/TITF1/TTF-1-Induced ROR1 is required to sustain EGFR survival signaling in lung adenocarcinoma.
22414081 2012 Novel patented SRC kinase inhibitor.
22402981 2012 Integrin/Fak/Src-mediated regulation of cell survival and anoikis in human intestinal epithelial crypt cells: selective engagement and roles of PI3-K isoform complexes.
22393415 2012 Nef alleles from all major HIV-1 clades activate Src-family kinases and enhance HIV-1 replication in an inhibitor-sensitive manner.
22388352 2012 Src tyrosine kinase inhibits apoptosis through the Erk1/2- dependent degradation of the death accelerator Bik.
22383989 2012 Genetic susceptibility on CagA-interacting molecules and gene-environment interaction with phytoestrogens: a putative risk factor for gastric cancer.
22378042 2012 c-Src and c-Abl kinases control hierarchic phosphorylation and function of the CagA effector protein in Western and East Asian Helicobacter pylori strains.
22361730 2012 Src-mediated aryl hydrocarbon and epidermal growth factor receptor cross talk stimulates colon cancer cell proliferation.
22354875 2012 Deficiency of Fyn protein is prerequisite for apoptosis induced by Src family kinase inhibitors in human mesothelioma cells.
22353809 2012 The interrelationships between Src, Cav-1 and RhoGD12 in transitional cell carcinoma of the bladder.
22328516 2012 The metastasis gene NEDD9 product acts through integrin ?3 and Src to promote mesenchymal motility and inhibit amoeboid motility.
22323579 2012 Phosphorylation of dedicator of cytokinesis 1 (Dock180) at tyrosine residue Y722 by Src family kinases mediates EGFRvIII-driven glioblastoma tumorigenesis.
22321370 2012 Preservation of NADH ubiquinone-oxidoreductase activity by Src kinase-mediated phosphorylation of NDUFB10.
22310287 2013 Combination of MEK and SRC inhibition suppresses melanoma cell growth and invasion.
22279592 2012 ErbB2, EphrinB1, Src kinase and PTPN13 signaling complex regulates MAP kinase signaling in human cancers.
22252554 2012 c-Src and IL-6 inhibit osteoblast differentiation and integrate IGFBP5 signalling.
22247553 2012 Fibronectin induces endothelial cell migration through ?1 integrin and Src-dependent phosphorylation of fibroblast growth factor receptor-1 at tyrosines 653/654 and 766.
22238675 2012 Trihydrophobin 1 phosphorylation by c-Src regulates MAPK/ERK signaling and cell migration.
22203239 2012 Exosomes released by K562 chronic myeloid leukemia cells promote angiogenesis in a Src-dependent fashion.
22200682 2012 A study of the suppressive effect on human pancreatic adenocarcinoma cell proliferation and angiogenesis by stable plasmid-based siRNA silencing of c-Src gene expression.
22134837 2012 Shorter disease-specific survival of ER-positive breast cancer patients with high cytoplasmic Src kinase expression after tamoxifen treatment.
22110760 2011 The PDZ-ligand and Src-homology type 3 domains of epidemic avian influenza virus NS1 protein modulate human Src kinase activity during viral infection.
22105363 2012 The kinase c-Src and the phosphatase TC45 coordinately regulate c-Fos tyrosine phosphorylation and c-Fos phospholipid synthesis activation capacity.
22052839 2012 Significant association of SRC protein expression with the progression, recurrence, and prognosis of oral squamous cell carcinoma in Taiwan.
22037769 2012 Identification of a Src tyrosine kinase/SIAH2 E3 ubiquitin ligase pathway that regulates C/EBP? expression and contributes to transformation of breast tumor cells.
21994943 2011 Cellular settings mediating Src Substrate switching between focal adhesion kinase tyrosine 861 and CUB-domain-containing protein 1 (CDCP1) tyrosine 734.
21994334 2011 Hepatitis B virus large surface antigen promotes liver carcinogenesis by activating the Src/PI3K/Akt pathway.
21984372 2012 CD24 promotes tumor cell invasion by suppressing tissue factor pathway inhibitor-2 (TFPI-2) in a c-Src-dependent fashion.
21961241 2011 [Inhibition of SRC-1 expression in prostate cancer cells by RNAi and its significance].
21953458 2011 Express path analysis identifies a tyrosine kinase Src-centric network regulating divergent host responses to Mycobacterium tuberculosis infection.
21875461 2011 [FAK/c-Src signaling pathway mediates the expression of cell surface HSP90 in cultured human prostate cancer cells and its association with their invasive capability].
21859709 2011 Src regulates Tyr(20) phosphorylation of transferrin receptor-1 and potentiates breast cancer cell survival.
21856747 2011 Ligand-dependent corepressor acts as a novel androgen receptor corepressor, inhibits prostate cancer growth, and is functionally inactivated by the Src protein kinase.
21840312 2011 Src-stimulated IRTKS phosphorylation enhances cell migration.
21798038 2011 Non-cysteine linked MUC1 cytoplasmic dimers are required for Src recruitment and ICAM-1 binding induced cell invasion.
21757754 2011 Distinct transcriptional regulation of human large conductance voltage- and calcium-activated K+ channel gene (hSlo1) by activated estrogen receptor alpha and c-Src tyrosine kinase.
21757638 2011 Paxillin is a novel cellular target for converging Helicobacter pylori-induced cellular signaling.
21741415 2011 Comparative role of acetylation along c-SRC/ETS1 signaling pathway in bone metastatic and invasive mammary cell phenotypes.
21737505 2011 Targeting SRC in mucinous ovarian carcinoma.
21725358 2012 The SRC-associated protein CUB Domain-Containing Protein-1 regulates adhesion and motility.
21725282 2011 Activation of Src and transformation by an RPTP? splice mutant found in human tumours.
21725161 2011 Crosstalk between activated and inactivated c-Src in hepatocellular carcinoma.
21724833 2011 Identification of PTPN23 as a novel regulator of cell invasion in mammary epithelial cells from a loss-of-function screen of the 'PTP-ome'.
21716326 2011 Suppression of E-cadherin function drives the early stages of Ras-induced squamous cell carcinoma through upregulation of FAK and Src.
21710320 2012 CD24 interacts with and promotes the activity of c-src within lipid rafts in breast cancer cells, thereby increasing integrin-dependent adhesion.
21703394 2011 Abnormal cell properties and down-regulated FAK-Src complex signaling in B lymphoblasts of autistic subjects.
21685945 2012 Rack1 promotes epithelial cell-cell adhesion by regulating E-cadherin endocytosis.
21681336 2011 [c-SRC knockdown decreases phosphorylated STAT3 expression and viability of HeLa cells].
21646863 2011 Src family kinases and paclitaxel sensitivity.
21637765 2011 Epithelial membrane protein-2 promotes endometrial tumor formation through activation of FAK and Src.
21632985 2011 A HIF-regulated VHL-PTP1B-Src signaling axis identifies a therapeutic target in renal cell carcinoma.
21618517 2012 Expression and pharmacological inhibition of thymidylate synthase and Src kinase in nonsmall cell lung cancer.
21613217 2011 Calmodulin mediates Fas-induced FADD-independent survival signaling in pancreatic cancer cells via activation of Src-extracellular signal-regulated kinase (ERK).
21573184 2011 A functional nuclear epidermal growth factor receptor, SRC and Stat3 heteromeric complex in pancreatic cancer cells.
21541295 2011 Simultaneous siRNA targeting of Src and downstream signaling molecules inhibit tumor formation and metastasis of a human model breast cancer cell line.
21536681 2011 Activation of cytosolic phospholipase A2 downstream of the Src-phospholipase D1 (PLD1)-protein kinase C ? (PKC?) signaling axis is required for hypoxia-induced pathological retinal angiogenesis.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
21509526 2012 KX-01, a novel Src kinase inhibitor directed toward the peptide substrate site, synergizes with tamoxifen in estrogen receptor ? positive breast cancer.
21508333 2011 c-Src inactivation reduces renal epithelial cell-matrix adhesion, proliferation, and cyst formation.
21496428 2011 [Effects of Src on proliferation and invasion of lung cancer cells].
21496277 2011 Transcriptional activation of the Axl and PDGFR-? by c-Met through a ras- and Src-independent mechanism in human bladder cancer.
21490433 2011 Trask phosphorylation defines the reverse mode of a phosphotyrosine signaling switch that underlies cell anchorage state.
21490376 2011 Clinicopathological significance of Y416Src and Y527Src expression in breast cancer.
21445970 2012 Human melanoma cells express FGFR/Src/Rho signaling that entails an adhesion-independent caveolin-1 membrane association.
21445358 2011 Activation of Src mediates PDGF-induced Smad1 phosphorylation and contributes to the progression of glomerulosclerosis in glomerulonephritis.
21442427 2011 Cdk5 targets active Src for ubiquitin-dependent degradation by phosphorylating Src(S75).
21411625 2011 A direct interaction between the large GTPase dynamin-2 and FAK regulates focal adhesion dynamics in response to active Src.
21390316 2011 Specific oncogenic activity of the Src-family tyrosine kinase c-Yes in colon carcinoma cells.
21383697 2011 MicroRNA-mediated downregulation of mTOR/FGFR3 controls tumor growth induced by Src-related oncogenic pathways.
21343398 2011 Steroid receptor coactivator-1 upregulates integrin ?? expression to promote breast cancer cell adhesion and migration.
21309750 2011 The Cdc42-associated kinase ACK1 is not autoinhibited but requires Src for activation.
21301049 2010 Src activates Abl to augment Robo1 expression in order to promote tumor cell migration.
21300758 2011 Functional roles of Src and Fgr in ovarian carcinoma.
21291860 2011 Integrin ??1, ?v?, ?6? effectors p130Cas, Src and talin regulate carcinoma invasion and chemoresistance.
21281808 2011 Tenascin C induces epithelial-mesenchymal transition-like change accompanied by SRC activation and focal adhesion kinase phosphorylation in human breast cancer cells.
21278788 2011 Translationally controlled tumor protein induces human breast epithelial cell transformation through the activation of Src.
21273440 2011 Ligand-dependent degradation of SRC-1 is pivotal for progesterone receptor transcriptional activity.
21268077 2011 Enterovirus 71 modulates a COX-2/PGE2/cAMP-dependent viral replication in human neuroblastoma cells: role of the c-Src/EGFR/p42/p44 MAPK/CREB signaling pathway.
21257711 2011 An EGFR-Src-Arg-cortactin pathway mediates functional maturation of invadopodia and breast cancer cell invasion.
21248042 2011 Src kinase mediates productive endocytic sorting of reovirus during cell entry.
21225226 2011 Differential roles of Src in transforming growth factor-ß regulation of growth arrest, epithelial-to-mesenchymal transition and cell migration in pancreatic ductal adenocarcinoma cells.
21195420 2012 Immunohistochemical and molecular analysis of tyrosine kinase activity in desmoid tumors.
21177802 2011 VEGFR2 and Src kinase inhibitors suppress Andes virus-induced endothelial cell permeability.
21169408 2011 Recovery of anoikis in Src-transformed cells and human breast carcinoma cells by restoration of the SIRP ?1/SHP-2 signaling system.
21156787 2011 The transmembrane adaptor Cbp/PAG1 controls the malignant potential of human non-small cell lung cancers that have c-src upregulation.
21151980 2010 Desmoglein 3, via an interaction with E-cadherin, is associated with activation of Src.
21075308 2010 Recombinant human erythropoietin antagonizes trastuzumab treatment of breast cancer cells via Jak2-mediated Src activation and PTEN inactivation.