Property Summary

Ligand Count 677
NCBI Gene PubMed Count 1,034
PubMed Score 9201.69
PubTator Score 3297.81

Knowledge Summary

Patent (365,075)

TINX Plot

  Disease (8)

Disease Target Count P-value
ovarian cancer 8520 1.6e-07
osteosarcoma 7950 2.4e-07
tuberculosis 2010 3.6e-05
group 4 medulloblastoma 1855 1.1e-04
psoriasis 6694 1.1e-04
COPD 118 2.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 6.867 3.4

Expression

  Differential Expression (6)

Disease log2 FC p
COPD -1.200 2.7e-03
group 4 medulloblastoma 1.100 1.1e-04
osteosarcoma 3.039 2.4e-07
ovarian cancer -1.100 1.6e-07
psoriasis 1.900 1.1e-04
tuberculosis -1.500 3.6e-05

Protein-protein Interaction (4)

PDB (60)

Gene RIF (635)

AA Sequence

MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSS      1 - 70
DTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYV     71 - 140
APSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKL    141 - 210
DSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGC    211 - 280
FGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL    281 - 350
DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT    351 - 420
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC    421 - 490
PESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL                            491 - 536
//

Text Mined References (1073)

PMID Year Title