Property Summary

NCBI Gene PubMed Count 4
PubMed Score 33.58
PubTator Score 13.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 1.5e-07
glioblastoma -1.400 2.8e-05
medulloblastoma -1.500 7.0e-08
medulloblastoma, large-cell -1.900 5.4e-05
fibroadenoma 1.100 6.7e-04
adult high grade glioma -1.100 3.9e-04

Gene RIF (1)

PMID Text
15777716 ADMP expression was seen predominantly in the prostate epithelium with weaker expression in the fibroblasts and endothelial cells.

AA Sequence

MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY      1 - 70
HSTISN                                                                     71 - 76
//

Text Mined References (5)

PMID Year Title
19416851 2009 Identification of small subunits of mammalian serine palmitoyltransferase that confer distinct acyl-CoA substrate specificities.
15777716 2005 Molecular cloning and characterization of a novel androgen repressible gene expressed in the prostate epithelium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.