Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.20
PubTator Score 1.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.207 2.9e-03
Breast cancer 2.300 4.1e-02
colon cancer -1.600 5.1e-03
ductal carcinoma in situ 1.300 8.3e-03
glioblastoma 1.100 3.8e-04
hereditary spastic paraplegia -1.018 1.5e-02
interstitial lung disease -1.600 2.4e-02
invasive ductal carcinoma -1.058 1.3e-02
lung adenocarcinoma 1.076 7.1e-03
lung cancer -2.300 4.1e-05
osteosarcoma 1.702 7.8e-04
ovarian cancer -1.500 5.0e-05
pancreatic ductal adenocarcinoma liver m... -1.036 1.2e-02
pediatric high grade glioma 1.200 1.6e-04
posterior fossa group A ependymoma 1.100 2.3e-04
psoriasis 1.500 3.6e-09

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIV      1 - 70
Q//

Text Mined References (7)

PMID Year Title